The present inventions relates to bioresorbable sealing powder comprising: (a) water-soluble electrophilic polymer carrying at least 3 reactive electrophilic groups that are capable of reacting with amine groups under the formation of a covalent bond; (b) water-soluble nucleophilic cross-linker carrying at least 2 reactive nucleophilic groups that, in the presence of water, are capable of reacting with the reactive electrophilic groups of the electrophilic polymer under the formation of a covalent bond between the electrophilic polymer and the nucleophilic cross-linker; (c) water-absorbing particles containing at least 50% by weight of said water-absorbing particles of water-insoluble polymer containing reactive nucleophilic groups; (d) water-soluble dispersant that is solid at 20°C, said water-soluble dispersant being selected from monosaccharides, disaccharides, oligosaccharides, sugar alcohols and combinations thereof. wherein the components (a), (b), (c) and (d) may be contained in the same particles or in different particles. The invention also provides a method of preparing the aforementioned bioresorbable sealing powder Further provided are (i) a device for powder application comprising the bioresorbable sealing powder, (ii) a biocompatible, flexible, hemostatic sheet comprising the bioresorbable sealing powder and (iii) a kit of parts for preparing a sealing suspension, said kit comprising the bioresorbable powder, and (iv) a sealing suspension containing the bioresorbable sealing powder.
Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.
C07K 16/18 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
Antibody and other Fc-containing molecules with variations in the Fc region with reduced binding to C1q and Fc gamma receptors are provided, which can be used in the treatment of various diseases and disorders.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
In some embodiments, an apparatus can include a robotic arm cart for transporting, delivering, and securing robotic arms to a surgical table having a table top on which a patient can be disposed. The arm cart can include an arm container and a base. The arm container can be configured to receive and contain one or more robotic arms. The arm cart can include a first coupling member configured to engage with a second coupling member associated with a surgical table such that, when the first coupling member is engaged with the second coupling member, the one or more robotic arms can be releasably coupled with the surgical table. The arm cart can provide for movement of the one or more robotic arms in at least one of a lateral, longitudinal, or vertical direction relative to the table top prior to the securement of the one or more robotic arms to the surgical table.
The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 iso forms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X6) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Y in amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
A method for determining a diffusion feature of a fluidic sample using redox reactions in an electrochemical cell that has at least two electrodes, wherein the first electrode has at least one redox mediator at its surface or in close vicinity of its surface, and the second electrode has an electrode surface free of the redox mediator(s) in the beginning of a test, the method comprising: applying an electric potential to a fluidic sample in the electrochemical cell to initiate redox reactions at the two electrode surfaces; measuring current associated with the applied potential as a function of time, and using a measurement point on a transient part of the measured current at or after a turning point and its associated time to determine the diffusion feature.
A test strip having conductive surfaces separated by a spacer layer, wherein the spacer layer is comprised of sections forming a plurality of sample chambers that enable the test strip to be inserted into a test meter in a number of possible orientations. The test strip also includes electrical contact pads on opposing sides thereof such that the test meter may separately engage the contact pads depending on the insertion orientation.
An injection device comprises an actuator adapted when actuated to cause commencement of an injection sequence; a locking mechanism adapted to be moved between a locked position in which the locking mechanism prevents the actuator from being actuated, and an unlocked position in which the actuator can be actuated to cause commencement of the injection sequence. An indicator is configured to provide a visual indication of whether the locking mechanism is in its locked position or in its unlocked position.
An injection device for delivering an injection comprises a housing having a longitudinal axis, a proximal end and a distal end, the housing being arranged such that the injection is delivered from its distal end; and a release mechanism comprising an impediment, the release mechanism being moveable between a first position, in which the impediment is in an impeding position so as to impede the delivery of the injection, and a second position, in which the impediment is in a non- impeding position so as to not impede the delivery of the injection, wherein the force required to move the release mechanism from the first position to the second position varies with the distance moved by the release mechanism, the variation in the force required with distance being represented by a force profile, which is non-linear.
An injection device for delivering an injection comprises a housing having a longitudinal axis, a proximal end and a distal end, the housing being arranged such that the injection is delivered from its distal end; and a release mechanism comprising an impediment, the release mechanism being moveable between a first position, in which the impediment is in an impeding position so as to impede the delivery of the injection, and a second position, in which the impediment is in a non-impeding position so as to not impede the delivery of the injection, wherein the force required to move the release mechanism from the first position to the second position varies with the distance moved by the release mechanism, the variation in the force required with distance being represented by a force profile, which is non-linear.
An injection device comprises an actuator adapted when actuated to cause commencement of an injection sequence; a locking mechanism adapted to be moved between a locked position in which the locking mechanism prevents the actuator from being actuated, and an unlocked position in which the actuator can be actuated to cause commencement of the injection sequence. The locking mechanism comprises a contact portion which in the locked position of the locking mechanism projects against the actuator. The contact portion comprises a curved surface.
The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6)DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
A61K 47/64 - Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
A61K 38/16 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
An analytical test strip ("ATT") for use with a test meter includes a first insulating layer, with a first insulating layer upper surface, and a first electrically conductive layer ("ECL") disposed thereon. The first ECL includes a first electrode portion ("EP") and an electrical contact pad in electrical communication with the first EP. The ATT also includes a patterned spacer layer disposed above the first ECL that includes (i) a distal portion defining a bodily fluid sample-receiving chamber therein that overlies the first EP and (ii) an insulating proximal portion with an upper surface having a second ECL disposed thereon. The second ECL includes an interlayer contact portion and an electrical contact pad. A third ECL of the ATT includes a second EP and a proximal portion that overlies the interlayer contact portion. The second EP is disposed overlying and exposed to the sample-receiving chamber in an opposing relationship to the first EP.
C12Q 1/00 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
Methods for distinguishing between an aqueous non-blood sample (e.g., a control solution) and a blood sample are provided herein. In one aspect, the method includes using a test strip in which multiple current transients and a capacitance are measured by a meter electrically connected to an electrochemical test strip. The current transients are used to determine if a sample is a blood sample or an aqueous non -blood sample based on characteristics of the sample (e.g., amount of interferent present, reaction kinetics, and/or capacitance). The method can also include calculating a discrimination criteria based upon these characteristics. Various aspects of a system for distinguishing between a blood sample and an aqueous non -blood sample are also provided herein.
C12Q 1/00 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
G01N 33/487 - Physical analysis of biological material of liquid biological material
A fluid transfer assembly (10) comprises means (12) for connection to a syringe and receiving means (11) for receiving a vial (14) having a closure element (14a). The receiving means (11) is adapted to engage and open the closure element (14a) and permit fluid in the vial (14) to be transferred to the syringe from the vial, for example by gravity acting on the fluid in the vial.
A61J 1/20 - Arrangements for transferring fluids, e.g. from vial to syringe
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/50 - Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm rests having means for preventing re-use, or for indicating if defective, used, tampered with or unsterile
An injection device comprises a first sub-assembly. The first sub-assembly comprises a chamber (116) for holding a fluid. The chamber comprises an inner surface and an exit aperture (114). The first sub-assembly comprises a stopper (112) movably disposed within the chamber and having an outer surface substantially in contact with the inner surface about its perimeter. The first sub-assembly comprises an adapter (118) adapted to transfer fluid into the chamber.
An auto-injector with an improved locking mechanism for ease of use is provided. The device comprises a syringe having a discharge nozzle moveably housed in a housing. In a retracted position the discharge nozzle is contained within the housing and in an extended position the discharge nozzle extends from the housing through an exit aperture. There is an actuator acting on a drive, which in turn acts on the syringe to advance it from its retracted position to its extended position, to discharge its contents. A locking mechanism is moveable from an engaged position in a direction into the housing at the exit aperture into a disengaged position. When in the engaged position, the locking mechanism prevents actuation of the device; while in the disengaged position, it permits actuation of the device. The locking mechanism comprises a contact surface extending over or around the rim of the exit aperture.
An injection device comprises a housing with a fluid container (114) having a discharge nozzle (118) and a dispensing piston (114) moveable in the fluid container to expel the contents of the fluid container out of the discharge nozzle. A drive is adapted on activation to act on the fluid container to advance it from a retracted position in which the discharge nozzle is contained within the housing to an extended position in which the discharge nozzle extends from the housing and act on the dispensing piston to expel the contents of the fluid container out of the discharge nozzle. A connector is adapted to receive a vial (400) containing fluid and connect it to the discharge nozzle. There is also means to move the dispensing piston relative to the flu-id container from a first position in which the dispensing piston is located in the fluid container adjacent the discharge nozzle to a--second position in which the dispensing piston has been drawn away from the discharge nozzle, thereby drawing fluid from the vial into the fluid container.
An injection device having a first sub-assembly (110) comprises a housing (111) and a chamber (112). The cham-ber is disposed within the housing and has proximal and distal ends, an inner surface and an exit aperture (114). The sub-assembly comprises a stopper (113) movably disposed within the chamber. The stopper has an outer surface substantially in contact with the inner surface about its perimeter. The sub-assembly comprises a port (118) adapted to receive a container (1199) containing a flu-id. The stopper is fixed with respect to the housing and movement of the port causes movement of the exit aperture in relation to the stopper.
An injection- system is provided which comprises an injection device (210) and a base station (240) which connects to the injection device. The base station resets the actuator mechanism in the injection device from its actuated state to its unactuated state so that further actuation of the actuator mechanism can take place.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device comprises a locking mechanism (171c) between a syringe carrier (127) and a release mechanism (102) to inhibit movement of the syringe carrier and syringe held by the syringe carrier towards an exit aperture of the injection device when the release mechanism is in its engaged position. The engaged position of the release mechanism is a position in which engagement of an actuator on the syringe is prevented. This assists in preventing damage to the syringe prior to actuation of the injection device.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
There is provided herein an injection device, comprising: a housing adapted to receive a syringe having a discharge nozzle, the syringe being movable within the housing along a longitudinal axis from a retracted position in which the discharge nozzle is contained within the housing and an extended position in which the discharge nozzle of the syringe extends from the housing through an exit aperture; an actuator; a drive adapted to be acted upon by the actuator an in turn act upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the discharge nozzle; a syringe carrier adapted to support the syringe as it is advanced; a return spring that biases the syringe from the extended position to the retracted position, wherein the return spring acts on the syringe via the syringe carrier; and a locking mechanism between the syringe carrier and the drive to inhibit movement of the syringe carrier and syringe towards the exit aperture.
An injection device comprises a locking mechanism (171-173) between a syringe carrier (127) and an end cap (111) of the injection device. The cap is formed in such a way to inhibit movement of the syringe carrier and syringe towards an exit aperture of the injection device when the drive has not been removed from the injection device. On removal of the cap, the locking mechanism is no longer so engaged and the syringe and syringe carrier can move towards the exit capture. This assists in preventing damage to the syringe prior to actuation of the injection device.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device comprises a locking-mechanism in the form of two buttons (17) located on the front end of the injection device. In an engaged position, the locking mechanism prevents removal of a cap (111) from the injection device and, in a disengaged position, prevents movement of a syringe carrier (127) holding a syringe but permits removal of the cap from the housing. This assists in preventing damage to the syringe prior to actuation of the injection device.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
25.
INJECTION DEVICE WITH LOCKING MECHANISM FOR SYRINGE CARRIER
An injection device comprises a locking mechanism (171a, 171b) between a syringe carrier (128) and an end cap (111) of the injection device. The cap is formed in such a way to inhibit movement of the syringe carrier and syringe towards an exit aperture of the injection device when the cap is located in its closed position on the injection device. A needle shield (123) located on the needle of the syringe is removed by rotating the cap whilst the locking mechanism remains engaged. On removal of the cap, the locking mechanism is no longer so engaged and the syringe and syringe carrier can move towards the exit aperture. This assists in preventing damage to the syringe prior to actuation of the injection device.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device is of the type which has a housing defining a first axis and which is adapted to receive a syringe having a discharge nozzle, so that the syringe is movable between a retracted position, in which the discharge nozzle is contained within the housing, and an extended position, in which the discharge nozzle extends from the housing through an exit aperture. A trigger is movable from a rest position, in which it causes the drive to be retained, to an active position, in which it no longer causes the drive to be retained. A releasable locking mechanism is movable from a first position, in which the trigger is prevented from moving into its active position, to a second position, in which the trigger can be moved to its active position. The trigger and the releasable locking mechanism are arranged such that the trigger moves to its active position when the releasable locking mechanism is moved to its second position whilst pressure is being applied to an activation surface of the trigger.
An injection device (110) is described having a housing (112) that receives a syringe (114) having a needle (118), wherein the syringe is supported in a syringe carrier (150). The injection device (110) has a removable cap (190). The syringe (114) and syringe carrier (150) are biased by a return spring (126) from an extended position in which the needle (118) extends from the housing (112) through an exit aperture (128) to a retracted position in which it does not. The syringe carrier (150) abuts a surface inside the removable cap (190) which prevents forward movement of the syringe carrier (150) when the cap is in place. The injection device is less prone to failure than prior art devices and is safer should failure occur.
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
28.
INJECTION DEVICE WITH A DAMPING MEANS ON THE TRIGGER
An injection device is provided having a housing and a drive that acts upon a syringe when released by a trigger. The trigger is rotatable from a rest position, which causes the drive to be retained, to an active position, in which it no longer causes the drive to be retained. A damping means is arranged in conjunction with the trigger to prevent accidental actuation of the device. A viscous fluid is provided as a damping means and positioned between an upper surface of the trigger and an inner surface of the housing. Such an injection device provides improved reliability and resilience to damage caused by impact forces, for example, when the device is dropped onto a hard surface. The trigger is also retained in its active position after actuation, indicating that the device has been used. Additionally, the noise production by the operation of the trigger, which may be distressing to a user, is reduced.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
There is described herein an improved injection device designed to overcome mechanical failures of components and/or syringe breakage during operation, and other problems. The improved injection comprising: a housing adapted to receive a syringe having a discharge nozzle, so that the syringe is movable between a retracted position in which the discharge nozzle is contained within the housing and an extended position in which the discharge nozzle extends from the housing through an exit aperture; a drive that acts upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the discharge nozzle, a syringe carrier that advances with the syringe; a restraining component that restrains the advancement of the syringe carrier as the syringe reaches its extended position; and a damping element that acts between the syringe carrier and the restraining component.
An injection device (110) is described having a housing (112) and a cap (130). The injection device (110) houses a syringe (114) having a needle which is sealed by a boot (118). The cap (130) is arranged so that the boot (118) can be connected to the cap (130) whilst exerting a minimal force on the syringe, but cannot be removed from the cap (130) without applying a significantly greater force to the syringe. The housing (112) and cap (130) are arranged so that upon removal of the cap (130) from the housing (112), the boot (118) is removed from the syringe (114).
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device is described having a housing, a drive element and a syringe carrier. The housing is adapted to receive a syringe having a discharge nozzle at a first end, the syringe being movable between a retracted position and an extended position in which it extends through an exit aperture. The drive element includes a syringe piston, which acts directly upon the syringe to advance it from its retracted position to its extended position and discharge its contents. The syringe carrier carries the syringe as it is advanced and has a first end through which the discharge nozzle extends. The syringe carrier includes, at its second end, means for restricting movement of the syringe relative to the syringe carrier to the second end whilst allowing some movement of the syringe in the direction from the first end to the second end of the syringe carrier.
An injection device (110) is described having a housing (112) that receives a syringe (114) having a sealed boot (123) that covers its needle (118). A releasable locking mechanism retains the syringe (114) in its retracted position. A sleeve (119) projects from the exit aperture (128) and can be depressed to release the locking mechanism. A removable threaded cap (111) closes the housing (112), covers the exit aperture (128) and the sleeve (119), thus preventing the locking mechanism from being released, and engages the boot (123) on the syringe (114). When the cap (111) is removed, it takes the boot (123) with it, no longer closes the exit aperture (128) and no longer prevents the locking mechanism from being released. Then, the locking mechanism can be released and the injection cycle begun.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A needle assembly (10; 210) for a prefilled injection syringe is described. A needle holder (12; 212) has a needle (14; 214) secured to it and is adapted to be secured to a syringe barrel of the injection syringe. A needle sheath (16; 216) has a distal end forming a releasable sterile seal with the needle holder (12; 212), and surrounds and shields the needle (14; 214) . A needle seal (18; 218) surmounts the needle tip and is arranged at least in part in the proximal end of the needle sheath (16; 216) and closed off by a closure element (20; 220) . A closure connection between the closure element (20; 220) and the needle sheath (16; 216) is configured as a non-releasable and sterile barrier (54; 254) produced by means of bonding or welding.
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device (110) comprises a housing (112) defining a first axis (101). A drive (120) acts upon a syringe when released by a trigger (114). The trigger is rotatable from a rest position in which the drive is retained to an active position in which it no longer causes the drive to be so retained. The trigger is pivotally mounted and has a surface (201) shaped such that a user can apply a force in a direction substantially parallel to the first axis to rotate the trigger from its rest position to its active position. Such an injection device provides improved handling and ease of operation.
An injection device (110) is provided which includes a syringe (122) having a discharge nozzle (118). The syringe is movable between a retracted position in which the discharge nozzle is contained within the housing and an extended position in which the discharge nozzle extends from the housing. A trigger (114) is activatable to allow the contents of the syringe to be discharged through the discharge nozzle. There is also a releasable locking mechanism (116) which, when engaged, prevents the trigger from moving into an active position. The trigger includes a first portion (150) having a cut-out (152) which extends from a first end of the trigger in a direction substantially parallel to the first axis (101). The releasable locking mechanism includes a protrusion (154) along a second axis (181) for communicating with the first portion of the trigger when the releasable locking mechanism is engaged and for communicating with the cut-out when the releasable locking mechanism is disengaged. Such an injection device provides improved protection against accidental activation of the trigger.
An injection device (110) comprises a housing (112) having a syringe (114) with a discharge nozzle (118) . The syringe is movable between a retracted position in which the discharge nozzle is contained within the housing and an extended position in which the discharge nozzle extends from the housing. There is a syringe cap (180) for enclosing the discharge nozzle. The syringe cap is removable from the syringe by rotation relative to the syringe. A syringe carrier (150) in the housing is adapted to restrain rotation of the syringe relative to the housing as the cap is removed.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device (110) comprises a housing (112) adapted to receive a syringe (116) having a discharge nozzle (118) and a dispensing piston (114) movable in the syringe to expel the contents of the syringe through the discharge nozzle. There is also a drive (130) adapted to act on the syringe to advance it from a retracted position in which the discharge nozzle is contained within the housing to an extended position in which the discharge nozzle extends from the housing. A drive coupling (134) extends from the drive to the dispensing piston of the syringe so as to transfer movement of the drive to the piston. The drive coupling comprises a fixed-length drive coupling and an interchangeable drive coupling. There is also a method of manufacturing an injection device by assembling a first sub-assembly (210) and second sub-assembly (220) .
An injection device (110) comprises a housing (112) adapted to receive a syringe (122) having a discharge nozzle (118) , an actuator (114) and a drive (120) acted upon by the actuator which acts upon the syringe to advance it from a retracted position in which the discharge nozzle is contained within the housing to an extended position in which the discharge nozzle extends from the housing. There is a locking mechanism (HS) in communication with the actuator and activatable to be moved from a locked position in which the actuator is prevented from releasing the drive to an unlocked position in which the actuator is operable to act upon the drive to advance the syringe. The locking mechanism or the housing includes integrally formed biasing means (210) adapted to return the locking mechanism to a locked position when it is not activated. There is no need for separate springs to be used to bias the releasable locking mechanism out of the housing.
A housing (212) receives a syringe and includes a return spring (226) for biasing the syringe from an extended position in which its needle (218) extends from the housing to a retracted position in which it does not. A drive spring (230) acts on a first drive element (232) and a second drive element (234) acts upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the needle. The first drive element is capable of movement relative to the second once a nominal coupling position has been reached. A release mechanism is activated when the first drive element (234) is further advanced to a nominal release position, to release the syringe (214) from the action of the drive spring, whereupon the return spring restores the syringe to its retracted position.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device (110) is described having a housing (112) that receives a syringe (114) having a needle (118), wherein the syringe is supported in a syringe carrier (150). The syringe and syringe carrier are biased by a return spring (126) from an extended position in which the needle (118) extends from the housing (112) through an exit aperture (128) to a retracted position in which it does not. A drive spring (130) acts via a drive to advance the syringe from its retracted position to its extended position and discharge its contents through the needle and a return spring, brought into play when the drive has reached a nominal return position, restores the syringe to its retracted position.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A housing (12; 112, 212) receives a syringe and includes a return spring (26; 126, 226) for biasing the syringe from an extended position in which its needle (18; 118, 218) extends from the housing to a retracted position in which the it does not. A drive spring (30; 130, 230) acts on a first drive elements (32; 132, 232) and a second drive element (34; 134, 234) acts upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the needle. The first drive element is capable of movement relative to the second when the former is acted upon by the drive spring and the latter is restrained by the syringe (14, 114, 214). A reservoir (48; 148, 248) is defined between the first drive element and the second drive element, the volume of the reservoir tending to decrease as the first drive element moves relative to the second when acted upon by the drive spring. The reservoir contains a highly viscous fluid and has a vent (44; 144, 244) through which the fluid escapes as the volume of the reservoir.
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
An injection device is described having a housing that receives a syringe. The syringe is biased by a return spring from an extended position in which the needle extends from the housing through an exit aperture to a retracted position in which it does not. A drive spring acts via a drive to advance the syringe from its retracted position to its extended position and discharge its contents through the needle and a return spring, brought into play when the drive has reached a nominal return position, restores the syringe to its retracted position. A releasable locking mechanism retains the syringe in its retracted position. A sleeve projects from the exit aperture and can be depressed to release the locking mechanism. A trigger has a rest position, in which it engages the drive, retaining it in a position corresponding to the retracted position of the syringe, and a depressed position, in which it no longer causes the drive to be so retained. The sleeve normally locks the trigger in its rest position. However, depression of the sleeve into the exit aperture, allows the trigger to be depressed. Thereafter, the trigger is retained in its active position.
The invention concerns an injection device (110) with a housing (112) adapted to receive a syringe (114) having a discharge nozzle (118) and a plunger (130). There is a trigger and a drive (134) arranged to act upon the plunger on actuation of the trigger to advance the syringe from a retracted position to an extended position through an opening (150) in the housing. A locking mechanism (160, 170) is arranged in and moveable relative to the housing. The locking mechanism is engaged with the plunger when the syringe is not in its extended position and disengaged from the plunger when the syringe is in its extended position. This means that movement of the plunger relative to the syringe is prevented when, in use, the syringe is advanced from a retracted position to an extended position. Hence the contents of the syringe are not expelled from the syringe during advancement form the retracted position to the extended position. Hence the contents of the syringe are not expelled from the syringe during advancement form the retracted position to the extended position. The contents are only expelled when the syringe reaches the extended position.
An injection device is described. A housing receives a syringe and includes a return spring for biasing the syringe from an extended position in which its needle extends from the housing to a retracted position in which the it does not. A drive spring acts on a first drive element and a second drive element acts upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the needle. The first drive element is capable of movement relative to the second once a nominal decoupling position has been reached. A release mechanism is activated when the first drive element is further advanced to a nominal release position, to release the syringe from the action of the drive spring, whereupon the return spring restores the syringe to its retracted position. The nominal decoupling and release positions are defined relative to the syringe. This may be achieved by interaction between a moving component and a decoupling component that moves with the syringe as it is advanced.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A syringe (114) is received with a housing, the syringe having a bore terminating at a forward end in a hypodermic needle (118) and at a rearward end in a flared opening (210) in which a bung (134a) having a bore (206) surrounded by a skirt (208) is inserted. A drive element (134) has a forward end consisting of a substantially flat annular region (200) that bears upon the skirt of the bung and surrounds a conical middle region (202) that is received in the bore (206) of the bung. An actuator advances the drive element (134) so as to advance the bung and discharge the contents of the syringe through the needle (118). The opening (210) in the rear of the glass syringe is flared by being provided with a radius. The combination of the radius at the opening and the projecting conical middle region of the drive element allows misalignments of the two to be managed during automated assembly.
The present invention concerns an injection device (110) with a housing (112) adapted to receive a syringe (114) having a discharge nozzle (118), the housing having an indicator opening (113). There is a trigger (111) and a forward drive (132) arranged to act upon the syringe on actuation of the trigger to advance the syringe form a retracted position to an extended position thereby discharging the contents of the syringe through the discharge nozzle. A support member (122) is in contacting juxtaposition with the housing and a return drive (126) is supported by the support member and arranged to act upon the syringe after the contents of the syringe has been discharged so that the syringe can be withdrawn from the extended position to the retracted position. Advantageously, the support member is arranged in the housing so that the second drive does not obscure an inspection of the contents of the syringe through the indicator opening. Hence, it can be clearly determined whether the contents of the syringe have been expelled from the syringe.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device (110) is described having a housing (112) and a housing closure means (130). The injection device (110) houses a syringe (114) having a needle (118) which is sealed by a boot (120). The housing closure means (130) is arranged so that the boot can be connected to the housing closure means simply, but cannot be removed from the housing closure means. The housing and housing closure means are arranged so that upon rotation of the housing closure means, the housing closure means is moved axially away from the housing and the boot and the boot is removed from the syringe. The injection device is simple to use and manufacture.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device (210) is described. A housing (212) receives a syringe and includes a return spring (226) for biasing the syringe from an extended position in which its needle (218) extends from the housing to a retracted position in which the it does not. A drive spring (230) acts on a first drive element (232) and a second drive element (234) acts upon the syringe to advance it from its retracted position to its extended position and discharge its contents through the needle. The first drive element is capable of movement relative to the second once a nominal decoupling position has been reached. A release mechanism is activated when the-first drive element is further advanced to a nominal release position, to release the syringe (214) from the action of the drive spring, whereupon the return spring restores the syringe to its retracted position. A locking mechanism (337, 375) confines the returned syringe in its retracted position.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
An injection device that retracts automatically is provided. A housing includes means for biasing the syringe from an extended position to a retracted position. The device includes an actuator and a drive, one comprising a flexible arm that engages with a drive surface on the other, allowing the actuator to prevent the former from moving relative to the latter. The arm is prevented from disengaging until the drive has been advanced to a nominal release position, whereupon the arm disengages, allowing the actuator to move relative to the drive and thus releasing the syringe from the action of the actuator, whereupon the biasing means restores the syringe to its retracted position. The arm is biased toward a position at which it engages the drive surface and the action of the actuator causes it to move against its bias, thus disengaging it from the drive surface.
A61M 5/20 - Automatic syringes, e.g. with automatically actuated piston rod, with automatic needle injection, filling automatically
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles