The hemostatic material composition contains a polysaccharide having a reactive group that reacts with a protein to form a crosslinking structure, a hydrophobic solvent, and a crosslinked particle containing one or more compounds selected from the group consisting of a crosslinked protein and a crosslinked polysaccharide.
A61K 38/17 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans
A61K 31/715 - Polysaccharides, i.e. having more than five saccharide radicals attached to each other by glycosidic linkages; Derivatives thereof, e.g. ethers, esters
The hemostatic material composition contains a polysaccharide having a reactive group that reacts with a protein to form a crosslinking structure and contains a hydrophobic solvent.
A61L 24/04 - Surgical adhesives or cements; Adhesives for colostomy devices containing macromolecular materials
3.
PRODUCTION METHOD OF POLYPEPTIDE, TAG, EXPRESSION VECTOR, EVALUATION METHOD OF POLYPEPTIDE, PRODUCTION METHOD OF NUCLEIC ACID DISPLAY LIBRARY, AND SCREENING METHOD
Provided is a production method of a polypeptide in which expressing a polypeptide as a tagged polypeptide is included, the method including expressing the tagged polypeptide from a nucleic acid containing a base sequence encoding a tag consisting of an amino acid sequence set forth in SEQ ID NO: 1, which is arranged immediately after a start codon, and a base sequence encoding a polypeptide that is arranged in-frame downstream of the base sequence encoding the tag,SEQ ID NO: 1: Val-Lys-Lys-(Xaa)n. (Xaa)n is a chain of n pieces of any amino acids, where n is an integer of 1 to 8, and the amino acids constituting (Xaa)n may be one type of amino acid or two or more types of amino acids.
The present invention addresses the problem of providing: a compound or a salt thereof which constitutes lipid particles that make it possible to achieve a high nucleic acid encapsulation rate and excellent nucleic acid delivery; and lipid particles and a pharmaceutical composition which use the same and make it possible to achieve a high nucleic acid encapsulation rate and excellent nucleic acid delivery. The present invention provides a compound represented by formula (1) or a salt thereof. In the formula, the symbols have the meanings as defined in the specification of the present application.
C07C 219/16 - Compounds containing amino and esterified hydroxy groups bound to the same carbon skeleton having esterified hydroxy groups and amino groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having at least one of the hydroxy groups esterified by an inorganic acid or a derivative thereof
A61K 47/18 - Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
5.
INFORMATION PROCESSING APPARATUS, INFORMATION PROCESSING METHOD, AND INFORMATION PROCESSING PROGRAM
This information processing device is equipped with at least one processor. Said processor performs processing which involves: receiving an input of structure data which expresses the structure of a chemical substance and an evaluation function for evaluating the specific performance of the chemical substance; extracting a known chemical substance, the basic structure of which is shared by the input structure represented by the inputted structure data, from a database for recording structure data which expresses said chemical substance structure for each of a plurality of known chemical substances; generating a novel structure by modifying the input structure on the basis of the extracted known chemical substance structure or modifying the extracted known chemical substance structure; deriving an indicator value pertaining to specific performance for the generated novel structure; deriving an evaluation value for the novel structure on the basis of the derived indicator value and the evaluation function; and displaying the novel structure according to the evaluation value.
This information processing device is provided with at least one processor. The processor performs a process comprising: receiving the inputs of partial structure data indicating a partial structure of a chemical substance, and a condition regarding an index value indicating performance of the chemical substance; with respect to each of a plurality of known chemical substances, extracting, from a database in which structure data indicating the structure of the chemical substance is recorded, a known chemical substance having an input partial structure that is the partial structure indicated by the partial structure data and satisfying the condition; extracting a partial structure other than the input partial structure included in the structure of the extracted known chemical substance, as a co-occurring partial structure; and displaying the extracted co-occurring partial structure.
The present disclosure relates to ?v?3 and/or ?v?5 integrins antagonist radiopharmaceuticals and their use in a theragnostic approach for selection and therapy of human subjects with tumors overexpressing ?v?3 and/or ?v?5 integrins. In particular, the present disclosure relates to a pharmaceutical composition of ?v 177Lu radiolabeled ?v?3 and/or ?v?5 integrins antagonist, for use in treating tumors overexpressing ?v?3 and/or ?v?5 integrins in a human subject eligible for said treatment, wherein said subject has been selected for the treatment by PET/CT or PET/MRI or SPECT/CT or SPECT/MRI imaging with the same ?v?3 and/or ?v?5 integrins antagonist but with 68-Ga as radiometal for use as imaging agent.
This information processing device: performs a control to display on a display device the structure of the chemical substance of an object to be processed, and a first index value indicating the function or structure of said chemical substance; accepts an operation to change the structure of the chemical substance displayed on the display device; performs a control to display on the display device the structure of the chemical substance after the change operation, and a second index value indicating the function or structure of the chemical substance after the change operation; and, when there is a partial structure that contributes to the change in value from the first index value to the second index value in the chemical substance after the change operation, performs a control to highlight the display of said partial structure.
This information processing device: performs a first search, in structure data representing the structure of a chemical substance to be tested, to search for partial structures included in partial structure data in which partial structures of the chemical substance and index values representing the performance or structure of these partial structures are associated; performs a second search to search for chemical substances that include the partial structures extracted by the first search, the second search performed in past data in which the structure of chemical substances and index values representing the performance or structure of the chemical substances and obtained through experimentation are associated; derives, on the basis of the total number of chemical substances extracted by the second search and the index values corresponding to those chemical substances, the reliability of the index values of the partial structures; and applies control to display, on a display device, the partial structures extracted by the first search and the reliability of those partial structures.
The present disclosure provides methods for generating and/or purifying secretomes, extracellular vesicles, and fractions thereof, from progenitor cells; and provides compositions containing such generated secretomes, extracellular vesicles, and fractions thereof. The present disclosure further provides methods for analyzing activities, and the functionality and potency, of such secretomes, extracellular vesicles, and fractions thereof. The present disclosure also relates to the therapeutic use of secretomes, extracellular vesicles, and fractions thereof. The present disclosure further relates to a good manufacturing practices (GMP)-ready, scalable, culture protocol for the release of clinic-ready secretomes.
The present disclosure provides methods for generating and/or purifying secretomes, extracellular vesicles, and fractions thereof, from cells, such as progenitor cells; and methods for analyzing activities, and the functionality and potency, of such secretomes, extracellular vesicles, and fractions thereof. The present disclosure also relates to the therapeutic use of secretomes, extracellular vesicles, and fractions thereof, analyzed using such methods.
Provided is a magnetorheological fluid containing magnetic particles, a carrier fluid, and an organic molybdenum compound, the magnetic particle content being 35?50 vol% (inclusive) with respect to the volume of the magnetorheological fluid, the viscosity of the carrier fluid measured by an electromagnetic rotary viscometer at a measurement temperature of 25°C being 10 mPa·s (millipascal seconds) or more, and the shear viscosity of the magnetorheological fluid measured at a shear rate of 1000 s?1 at a measurement temperature of 25°C being 500 mPa·s or less. Also provided are a magnetorheological fluid device including said magnetorheological fluid, and a method for manufacturing said magnetorheological fluid. The method for manufacturing said magnetorheological fluid includes resonant acoustic mixing of a mixture containing said magnetic particles, carrier fluid, and organic molybdenum compound.
H01F 1/44 - Magnets or magnetic bodies characterised by the magnetic materials therefor; Selection of materials for their magnetic properties of magnetic liquids, e.g. ferrofluids
An object of an aspect of the present invention is to provide an anti-tumor agent that exhibits a remarkably excellent anti-tumor effect. According to the present invention, there is provided an anti-tumor agent for curing cancer, the anti-tumor agent containing a liposome containing an inner water phase and an aqueous solution dispersing the liposome, which constitutes an outer water phase, in which the liposome encompasses gemcitabine or a salt thereof, a lipid constituting the liposome contains at least hydrogenated soybean phosphatidylcholine, 1,2-distearoyl-3-phosphatidylethanolamine-polyethylene glycol, and cholesterol, and the gemcitabine or the salt thereof encompassed in the liposome is administered at a dose rate of 1.0 mg/m2 body surface area to 240 mg/m2 body surface area per administration.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
14.
MARKERS SPECIFIC FOR PLURIPOTENT STEM CELLS, AND METHODS OF USING THE SAME
The present disclosure provides markers specific for pluripotent stem cells. In particular, the present disclosure relates to nucleic acid and polypeptide markers that are selectively expressed by pluripotent stem cells; and to methods for detecting the presence and/or absence of one or a plurality of pluripotent stem cells, by detecting such markers.
C12Q 1/6881 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for tissue or cell typing, e.g. human leukocyte antigen [HLA] probes
An object of the present invention is to provide a lipid composition capable of achieving excellent nucleic acid delivery for a wide variety of nucleic acids. According to the present invention, there is provided a lipid composition containing a first lipid which is a lipid represented by Formula (1) or a salt thereof, sterols, and nucleic acid, in which a ratio of the number of moles of the first lipid in the lipid composition to the number of moles of sterols in the lipid composition is 0.300 or more and less than 1.299. In the formula, X represents -NR1- or -O-, R1 represents a hydrogen atom, a hydrocarbon group, or the like, R2 and R3 each independently represent a hydrogen atom, a hydrocarbon group, or the like, R4, R5, R6, R7, R8, R9, R10, R11, and R12 each independently represent a hydrogen atom or an alkyl group,groups in any one or more pairs among R4 and R5, R10 and R5, R5 and R12, R4 and R6, R5 and R6, R6 and R7, R6 and R10, R12 and R7, and R7 and R8 may be linked to each other to form a 4- to 7-membered ring which may contain an O atom, a, b, c, and d are each independently represent an integer of 0 to 3, a + b is 1 or more, and c + d is 1 or more.
The present invention addresses the problem of providing a lipid composition which enables excellent nucleic acid delivery. According to the present invention, a lipid composition is provided, which contains a lipid represented by formula (1) or a salt thereof, a nonionic lipid, a lipid having a nonionic hydrophilic polymer structure and a nucleic acid and contains or does not contain a zwitterionic lipid, wherein the requirement represented by the formula: 40 < (A)-(B) ? 90 is satisfied, in which (A) represents the molar ratio, in terms of percentage, of the lipid represented by formula (1) or the salt thereof to all of the lipids constituting the lipid composition and (B) represents the molar ratio, in terms of percentage, of the zwitterionic lipid to all of the lipids constituting the lipid composition. In the formula, X represents -NR1- or -O-; R1 represents a hydrogen atom, a hydrocarbon group or the like; R2 and R3 independently represent a hydrogen atom, a hydrocarbon group or the like; R4, R5, R6, R7, R8, R9, R10, R11 and R12 independently represent a hydrogen atom or an alkyl group; residues of at least one pair selected from R4 and R5, R10 and R5, R5 and R12, R4 and R6, R5 and R6, R6 and R7, R6 and R10, R12 and R7, and R7 and R8 may be linked to each other to form a 4- to 7-membered ring which may contain an O atom; and a, b, c and d independently represent an integer of 0 to 3, wherein a+b is 1 or more and c+d is 1 or more.
A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
A61K 31/7088 - Compounds having three or more nucleosides or nucleotides
A61K 31/713 - Double-stranded nucleic acids or oligonucleotides
A61K 47/14 - Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
A61K 47/18 - Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
A61K 47/24 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing atoms other than carbon, hydrogen, oxygen, halogen, nitrogen or sulfur, e.g. cyclomethicone or phospholipids
A61K 47/28 - Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
A61K 47/34 - Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
One purpose of this invention is to provide a method, program, and device that make it possible to calculate a feature value that accurately represents the chemical properties of a structure of interest. Another purpose of this invention is to provide a method and program that make it possible to efficiently screen for a drug candidate compound using a feature value. Another purpose of this invention is to provide a method that makes it possible to efficiently create the three-dimensional structure of a drug candidate compound using a feature value. Similarity between the degrees of probe accumulation of structures of interest indicates similarity between the chemical properties of the structures of interest; that is, structures of interest having similar feature values calculated according to a first embodiment have similar chemical properties. Therefore, the first embodiment makes it possible to calculate a feature value that accurately represents the chemical properties of a structure of interest.
G16B 40/00 - ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
G01N 33/50 - Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
18.
METHOD FOR PRODUCING PEPTIDE COMPOUND, PROTECTING GROUP-FORMING REAGENT, AND CONDENSED POLYCYCLIC AROMATIC HYDROCARBON COMPOUND
Provided are: a method for producing a peptide compound, the method including a step for using a fused polycyclic aromatic hydrocarbon compound represented by formula (1); a protecting group-forming reagent that contains said compound; and said compound. In formula (1), ring A denotes a fused polycyclic aromatic hydrocarbon ring, YA moieties each independently denote -CH2OH, -CH2NHR, -CH2SH or -CH2X0, R denotes a hydrogen atom, an alkyl group or an aralkyl group, X0 denotes Cl, Br or I, k denotes an integer between 1 and 5, n denotes 1 or 2, and RA moieties each independently denote an aliphatic hydrocarbon group or an organic group having an aliphatic hydrocarbon group.
Provided are: a method for producing a peptide compound, the method including a step for using an aromatic heterocyclic compound represented by formula (1); a protecting group-forming reagent that contains said compound; and said compound. In formula (1), ring A denotes an aromatic heterocyclic ring, YA moieties each independently denote -OH, -NHR, -SH or -X0, X0 denotes Cl, Br or I, RA and RC moieties each independently denote an aliphatic hydrocarbon group or an organic group having an aliphatic hydrocarbon group, RB moieties each independently denote a monovalent aliphatic hydrocarbon group, a (1+c)-valent aromatic group or a (1+c)-valent heteroaromatic group, RB is a monovalent aliphatic hydrocarbon group in a case where both a and c are 0, and the number of carbon atoms in an aliphatic hydrocarbon group in at least one of RA, RB, and RC is 12 or more.
C07D 209/08 - Indoles; Hydrogenated indoles with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, directly attached to carbon atoms of the hetero ring
C07D 207/333 - Radicals substituted by oxygen or sulfur atoms
C07D 209/86 - Carbazoles; Hydrogenated carbazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the ring system
C07D 231/12 - Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
The present invention addresses the problem of providing an antitumor agent for acute myeloid leukemia, the antitumor agent exhibiting practical effects on acute myeloid leukemia. According to the present invention, provided is an antitumor agent for acute myeloid leukemia, the antitumor agent containing a compound, such as (S,E)-N-(1-((5-(2-((4-cyanophenyl)amino)-4-(propylamino)pyrimidin-5-yl)-4-pentyn-1-yl)amino)-1-oxopropan-2-yl)-4-(dimethylamino)-N-methyl-2-butenamide, represented by general formula [1] specified in the present specification, or a salt thereof, wherein the amount of the antitumor agent administered per dose is within a predetermined range.
Provided are a medical-image processing device and method, a machine learning system, and a program that can restrain the amount of communication, alleviating the burden of processing for relearning or additional learning performed by a machine learning device. A medical-image processing device (13) is provided with: a learner (26) that performs additional learning for a first computer-aided diagnosis device on the basis of an input medical image; an evaluation unit that compares a second computer-aided diagnosis device, which is obtained through the additional learning, with the first computer-aided diagnosis device to evaluate whether or not learned difference information resulting from the additional learning contributes to a performance improvement of the first computer-aided diagnosis device; a communication determination unit that determines, on the basis of the result of the evaluation, whether or not it is necessary to communicate the learned difference information; and a communication unit (34) that outputs the learned difference information according to the result of the determination by the communication determination unit.
The present invention addresses the problem of providing a medicine prepared by combining a liposome composition with an immune checkpoint blockade, wherein gemcitabine is encapsulated in a dissolved state in liposomes in the liposome composition. According to the present invention, a medicine which is a combination of (A) a liposome composition with (B) an immune checkpoint blockade is provided, wherein the liposome composition comprises liposomes each having an inner aqueous phase and an aqueous solution constituting an outer aqueous phase and having the liposomes dispersed therein, gemcitabine is encapsulated in a dissolved state in the liposomes, and the liposome composition and the immune checkpoint blockade are administered simultaneously or sequentially.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
The present invention addresses the problem of providing: a compound or a salt thereof, which constitutes lipid particles that enable the achievement of high nucleic acid encapsulation rate and excellent nucleic acid delivery; and lipid particles which use this compound or a salt thereof, and which enable the achievement of high nucleic acid encapsulation rate and excellent nucleic acid delivery. The present invention provides a compound represented by formula (1) or a salt thereof. In the formula, X represents -NR1- or -O-; R1 represents a hydrogen atom, a hydrocarbon group or the like; each of R2 and R3 independently represents a hydrogen atom, a hydrocarbon group or the like; each of R4, R5, R6, R7, R8, R9, R10, R11 and R12 independently represents a hydrogen atom, an alkyl group or the like; one or more pairs selected from among a pair of R4 and R5, a pair of R10 and R5, a pair of R5 and R12, a pair of R4 and R6, a pair of R5 and R6, a pair of R6 and R7, a pair of R6 and R10, a pair of R12 and R7, and a pair of R7 and R8 may combine with each other and form a 4- to 7-membered ring that may contain an O atom; and each of a, b, c and d independently represents an integer of 0-3, provided that (a + b) is 1 or more and (c + d) is 1 or more.
C07C 219/16 - Compounds containing amino and esterified hydroxy groups bound to the same carbon skeleton having esterified hydroxy groups and amino groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having at least one of the hydroxy groups esterified by an inorganic acid or a derivative thereof
A61K 47/14 - Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
A61K 47/18 - Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
A61K 47/22 - Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
A61K 47/24 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing atoms other than carbon, hydrogen, oxygen, halogen, nitrogen or sulfur, e.g. cyclomethicone or phospholipids
A61K 47/28 - Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
C07C 271/12 - Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to hydrogen atoms or to carbon atoms of unsubstituted hydrocarbon radicals
C07C 271/16 - Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by singly-bound oxygen atoms
C07C 271/22 - Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by carboxyl groups
C07D 211/42 - Oxygen atoms attached in position 3 or 5
C07D 211/46 - Oxygen atoms attached in position 4 having a hydrogen atom as the second substituent in position 4
C07D 295/13 - Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms with the ring nitrogen atoms and the substituent nitrogen atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings to an acyclic saturated chain
24.
PENAM DERIVATIVE OR SALT THEREOF, PHARMACEUTICAL COMPOSITION, AND APPLICATIONS THEREOF
The problem addressed by the present invention is to provide compounds and pharmaceutical compositions that demonstrate strong antibacterial activity against gram-negative bacteria and drug-resistant gram-negative bacteria. Compounds represented by general formula [1] (in the formula, each symbol is as described in the specification.) or salts thereof have strong antibacterial activity against gram-negative bacteria, including Pseudomonas aeruginosa, and drug-resistant gram-negative bacteria, including multidrug-resistant Pseudomonas aeruginosa, and pharmaceutical compositions containing these compounds or salts are useful as antimicrobials.
C07D 499/00 - Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula: , e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
A61K 31/431 - Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula , e.g. penicillins, penems containing further heterocyclic ring systems, e.g. ticarcillin, azlocillin, oxacillin
A61K 31/4439 - Non-condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
A61K 31/497 - Non-condensed pyrazines containing further heterocyclic rings
The present invention addresses the problem of providing an antitumor agent and an antitumor kit having a superior antitumor effect in comparison to gemcitabine, an antitumor platinum complex and a combination therapy thereof, and an antitumor effect potentiator. Provided is an antitumor agent that comprises an antitumor platinum complex and 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine or a salt thereof.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
Provided is a microfluidic channel device comprising: a first microfluidic channel formed in a first flow path member; a second microfluidic channel formed in a second flow path member and at least partially overlapping with the first microfluidic channel in a plan view, a step part being formed between the second microfluidic channel and the first microfluidic channel; a porous film having a plurality of pores that penetrate the porous film in the thickness direction, the porous film being disposed between the first flow path member and the second flow path member so as to separate the first microfluidic channel and the second microfluidic channel from each other; and a reinforcing member disposed between the porous film and the first flow path member or the second flow path member and having higher rigidity than the porous film, the reinforcing member reinforcing at least a portion, of the porous film, that faces the step part.
B81B 3/00 - Devices comprising flexible or deformable elements, e.g. comprising elastic tongues or membranes
B01J 19/00 - Chemical, physical or physico-chemical processes in general; Their relevant apparatus
G01N 37/00 - INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES - Details not covered by any other group of this subclass
C12M 1/34 - Measuring or testing with condition measuring or sensing means, e.g. colony counters
The purpose of the present invention is to provide a flow path device in which both optical measurements and electrical measurements can be performed. This purpose is met by comprising a first flow path member having a first flow path, a second flow path member having a second flow path, a porous film provided between the first flow path member and the second flow path member, and a pair of transparent electrodes provided with the first flow path and the second flow path interposed therebetween.
G01N 37/00 - INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES - Details not covered by any other group of this subclass
28.
METHOD FOR INDUCING DIFFERENTIATION OF PLURIPOTENT STEM CELLS INTO INTESTINAL EPITHELIAL CELLS
PUBLIC UNIVERSITY CORPORATION NAGOYA CITY UNIVERSITY (Japan)
FUJIFILM CORPORATION (Japan)
Inventor
Matsunaga, Tamihide
Iwao, Takahiro
Kabeya, Tomoki
Mima, Shinji
Miyashita, Toshihide
Abstract
The present invention addresses the problem of providing a novel means whereby cells showing a function more closely similar to the function of intestinal epithelial cells of a living body can be easily and efficiently prepared. According to the present invention, differentiation of pluripotent stem cells into intestinal epithelial cells is induced by: (1) a step for differentiating the pluripotent stem cells into intestinal stem cell-like cells; and (2) a step for differentiating the intestinal stem cell-like cells obtained in step (1) into intestinal epithelial cell-like cells with the combined use of an MEK1 inhibitor, a DNA methylation inhibitor, a TGFß receptor inhibitor, EGF and a cAMP activator.
C12N 1/00 - Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
C12Q 1/02 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
29.
ANTITUMOR AGENT FOR BILIARY TRACT CANCER AND METHOD FOR TREATING BILIARY TRACT CANCER
The purpose of the present invention is to provide an antitumor agent for biliary cancer which exhibits an effect against biliary cancer, and a treatment method of biliary cancer. An antitumor agent for biliary cancer is provided that contains 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine or a salt or a prodrug thereof.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
There is provided a medical examination support apparatus in which the history of diagnosis can be easily grasped at a glance, and an operation method and an operation program thereof A screen output control unit (66) of a medical examination support server (12) generates a log display screen (95) and transmits the log display screen (95) to a client terminal (11). In a collective display region (97) in the log display screen (95), an APL block (99) and a MOL block (100) are collectively displayed in a time series in a distinguishable manner. The APL block (99) is a display block of an automatic processing log APL which is a history of automatically performing analysis processing on examination data obtained in a medical examination performed on a patient by a diagnosis support algorithm (30) to output a result of the analysis processing as diagnosis support information for supporting diagnosis of a doctor. The MOL block (100) is a display block of a manual operation log MOL which is a history of a manual operation of the doctor with respect to the examination data.
There are provided a medical examination support apparatus which can select a suitable diagnosis support algorithm for a plurality of pieces of examination data without the intervention of a doctor, and an operation method and an operation program thereof. A request receiving unit (60) of a medical examination support server (12) receives at least two selection instructions among a plurality of pieces of examination data obtained in a medical examination performed on a patient. An algorithm selection unit (62) selects a suitable diagnosis support algorithm (30C) according to at least two pieces of the examination data from among the plurality of diagnosis support algorithms (30). An analysis processing unit (63) performs analysis processing by the suitable diagnosis support algorithm (30C). A screen output control unit (65) controls an output of an information display screen (95) including an information display region (102) in which diagnosis support information of the suitable diagnosis support algorithm (30C) is displayed.
The object of the present invention is to provide a therapeutic agent for use in treating hyperphosphatemia capable of sufficiently decreasing a serum phosphorus concentration with a small dose, and particles therefor. The present invention provides a therapeutic agent for hyperphosphatemia, which comprises, as an active ingredient, a particle containing a crosslinked polymer having at least a repeating unit A represented by the following formula (1-1) or (1-2) and a repeating unit B represented by the following formula (2-1) or (2-2), or a salt thereof, wherein the particle has an average particle diameter of 20 to 150 µm and a swelling rate of 9 to 16 mL/g. (see formula (1-2)(see formula(1-2) (see formula (2-1)(see formula(2-2)
A method for producing a cell laminate, said cell laminate comprising cell layers on the both faces of a porous film, by using a container consisting of a bottom and a side wall rising from the outer edge of the bottom, the porous film, and a holding member holding the porous film at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face, said method comprising: culturing first cells in a liquid medium, which is in contact with the inner bottom face of the container and the surface of the porous film, in such a state that the porous film is held by the holding member at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face and the bottom of the container is positioned upper than the porous film along the direction of the gravity; and culturing the first cells on the lower face of the porous film and culturing second cells on the upper face of the porous film in such a state that the porous film is held by the holding member at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face and the bottom of the container is positioned lower than the porous film along the direction of the gravity.
This micro flow passage device includes: a flow passage unit which is configured from a plurality of flow passage members which are stacked in a thickness direction to define a micro flow passage, wherein at least one flow passage member comprises a resilient material; and a holding member which is provided separately from or integrally with the flow passage unit, and which holds the flow passage unit in a state of compression in the thickness direction.
B81B 1/00 - Devices without movable or flexible elements, e.g. microcapillary devices
B01J 19/00 - Chemical, physical or physico-chemical processes in general; Their relevant apparatus
G01N 37/00 - INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES - Details not covered by any other group of this subclass
C12M 3/00 - Tissue, human, animal or plant cell, or virus culture apparatus
The present disclosure provides a blood vessel model including: a pair of channel members, mutually opposing each other, each of which includes an opposing face in which a respective microchannel is formed; and a porous membrane that includes plural through-holes penetrating in a thickness direction, that is disposed between the opposing faces of the pair of channel members, and that partitions between the microchannels, wherein the porous membrane is provided with a vascular endothelial cell layer so as to cover one face facing one of the microchannels, an average opening diameter of the through-holes is from 1 µ?? to 20 µm, and an opening coverage ratio of the through-holes is from 30% to 70%.
A living tissue model device includes: a first liquid compartment storing a liquid composition; a second liquid compartment storing a liquid composition; and a cell layered body disposed between the first liquid compartment and the second liquid compartment, as a partition between both compartments. A vascular wall model includes: a porous membrane having a honeycomb structure; a vascular endothelial cell layer disposed on one face of the porous membrane; and a smooth muscle cell layer, or a mesenchymal stem cell layer, disposed on another face of the porous membrane. A vascular wall model device includes: a first liquid compartment storing a liquid composition; a second liquid compartment storing a liquid composition; and a vascular wall model disposed between the first liquid compartment and the second liquid compartment, as a partition between both compartments. Applications of these models or model devices are also provided.
C12M 3/06 - Tissue, human, animal or plant cell, or virus culture apparatus with filtration, ultrafiltration, inverse osmosis or dialysis means
C12N 5/071 - Vertebrate cells or tissues, e.g. human cells or tissues
C12N 5/077 - Mesenchymal cells, e.g. bone cells, cartilage cells, marrow stromal cells, fat cells or muscle cells
C12M 3/00 - Tissue, human, animal or plant cell, or virus culture apparatus
C12M 3/04 - Tissue, human, animal or plant cell, or virus culture apparatus with means providing thin layers
C12N 5/00 - Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
C12N 11/00 - Carrier-bound or immobilised enzymes; Carrier-bound or immobilised microbial cells; Preparation thereof
C12Q 1/00 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
C12Q 1/02 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
37.
LIPOSOME COMPOSITION AND PHARMACEUTICAL COMPOSITION
The present invention addresses the problem of providing a liposome composition and a pharmaceutical composition that exhibit a high AUC. The present invention provides: a liposome composition that contains, as constituent components of the liposome membrane, a diacylphosphatidylethanolamine modified by a hydrophilic polymer, a dihydrosphingomyelin, and cholesterols; and a pharmaceutical composition containing the liposome composition, wherein the liposome composition encapsulates a drug, an inner aqueous phase thereof contains ammonium sulfate, and the molar ratio of sulfate ions in the inner aqueous phase to the drug in the entire aqueous phase is equal to or greater than 0.36.
A61K 31/4745 - Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenanthrolines
A61K 31/704 - Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin, digitoxin
A61K 47/24 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing atoms other than carbon, hydrogen, oxygen, halogen, nitrogen or sulfur, e.g. cyclomethicone or phospholipids
A61K 47/28 - Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
Provided is a cyclic peptide having excellent antibody binding properties and improved chemical resistance. The cyclic peptide is represented by formula (I) below. (I) RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC. In formula (I), RN represents an N-terminal group; RC represents a C-terminal group; X1 represents an L-leucine residue, L-isoleucine residue, L-methionine residue, L-lysine residue, or L-arginine residue; X2 represents an L-valine residue or L-isoleucine residue; X3 represents an L-tryptophan residue or L-phenylalanine residue; one among Xa and Xb represents an amino acid residue derived from an amino acid having an azide group in a side chain, the other represents an amino acid residue derived from an amino acid having an alkynyl group in a side chain, and Xa and Xb are bonded via a triazole bond; Xg, Xh, Xi, Xj, Xm, and Xn respectively represent contiguous g X's, contiguous h X's, contiguous i X's, contiguous j X's, contiguous m X's, and contiguous n X's; X represents an amino acid residue, and when there are a plurality of X's, the plurality of X's may be the same or different; g, h, i, and j are each independently an integer of 0 or greater; m and n are integers satisfying 0=m=9, 0=n=9, and 3=m+n=9; and k is an integer of 1 or greater, and when k=2, each of X1, X2, X3, Xa, Xb, Xi, Xj, Xm, and Xn may be the same or different for each of the repeating units [Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj].
C07K 7/00 - Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
A61K 47/65 - Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
A61K 47/68 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
A61K 39/395 - Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
C07K 1/22 - Affinity chromatography or related techniques based upon selective absorption processes
C07K 16/00 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies
39.
COMBINATION OF PACLITAXEL AND 1-(2-DEOXY-2-FLUORO-4-THIO-BETA-D-ARABINOFURANOSYL)-CYTOSINE AS ANTI-TUMOR AGENT
An object of the present invention is to provide an anti-tumor agent and an anti-turnor kit which have superior anti-tumor effect as compared with a therapy with gerncitabine, paclitaxel or a combination thereof; as well as an anti-tumor effect enhancer. According to the present invention, provided is an anti-tumor agent including paclitaxel or a salt thereof and 1-(2-deoxy-2-fluoro-4-thio-p-D-arabinofuranosyl)cytosine or a salt or prodrug thereof.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
Provided is a method for industrially producing 5-(bromomethyl)-1-benzothiophene. The production method according to the present invention comprises: (1) a step for introducing 5-methyl-1-benzothiophene, a brominating agent, and a solvent into a reactor; (2) a step for emitting light having a wavelength range of 200-780 nm inside the reactor; and (3) a step for recovering 5-(bromomethyl)-1-benzothiophene from the reactor.
C07D 333/54 - Benzo [b] thiophenes; Hydrogenated benzo [b] thiophenes with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the hetero ring
An object of the present invention is to provide a liquid medicinal preparation which does not generate precipitates and is suitable for mass production. According to the present invention, provided is a liquid medicinal preparation that contains 1-(2-deoxy-2-fluoro-4-thio-.beta.-D-arabinofuranosyl)cytosine or a salt thereof, a polyhydric alcohol having a molecular weight of 100 or less, and water. The polyhydric alcohol is preferably glycerin, propylene glycol, or butanediol.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
Provided is a cyclic peptide that is represented by formula (I) or formula (I'), has excellent antibody-binding characteristics, and also has improved drug stability. Also provided are an affinity chromatography support, a labeled antibody, an antibody-drug conjugate, and a pharmaceutical preparation. RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC...(I) In formula (I): Xa and Xb each independently represents an amino acid residue derived from an amino acid that has a thiol group in a side chain thereof other than L-cysteine and D-cysteine, Xa and Xb each being bonded via a disulfide bond; or one of Xa and Xb represents an amino acid residue derived from an amino acid that has a thiol group in a side chain thereof other than L-cysteine and D-cysteine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond. RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC...(I') In formula (I'): one of Xa and Xb represents an amino acid residue derived from L-cysteine or D-cysteine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond; or one of Xa and Xb represents an amino acid residue derived from L-penicillamine or D-penicillamine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond.
C07K 7/00 - Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
A61K 47/50 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
A61K 39/395 - Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
A61K 47/42 - Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
An object of the present invention is to provide a method for industrially manufacturing a nitrogen-containing heterocyclic compound which shows excellent FLT3 inhibitory activity and is useful as a pharmaceutical active ingredient of pharmaceutical products. The present invention provides a manufacturing method of a compound represented by General Formula [14] or a salt thereof (in the formula, R1 represents a C1-6 alkyl group which may be substituted; and R8 represents a leaving group or the like). (see above formula)
A61K 31/505 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
A61P 43/00 - Drugs for specific purposes, not provided for in groups
44.
METHOD FOR MANUFACTURING NOVEL NITROGEN-CONTAINING COMPOUND OR SALT THEREOF AND MANUFACTURING INTERMEDIATE OF NOVEL NITROGEN-CONTAINING COMPOUND OR SALT THEREOF
Provided are an efficient method for producing a nitrogen-containing compound or salt thereof to be used in the production of a treatment agent for diseases involving an integrin. Also provided is a production intermediate of the same. A method for producing a novel nitrogen-containing compound or salt thereof, said method comprising: (1) a step for obtaining a compound represented by general formula [10] or salt thereof by an amidation reaction; and (2) a step for deprotecting the compound represented by general formula [10] or salt thereof.
A61P 43/00 - Drugs for specific purposes, not provided for in groups
C07B 59/00 - Introduction of isotopes of elements into organic compounds
C07D 255/02 - Heterocyclic compounds containing rings having three nitrogen atoms as the only ring hetero atoms, not provided for by groups not condensed with other rings
C07D 257/02 - Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms not condensed with other rings
Disclosed are a compound and a pharmaceutical composition that exhibit an excellent drug efficacy against a tumor, in particular a tumor which has acquired resistance to gemcitabine. Specifically, provided is a thionucleoside derivative represented by General (see formula 1) (in the formula, R1 represents a hydroxyl group which may be protected, a C1- 20 alkoxy group which may be substituted, or the like; R2 represents a C1-20 alkoxy group which may be substituted, a C3-8 cycloalkoxy group which may be substituted, or the like; and R3 represents a hydrogen atom or the like); or a salt thereof. Further, provided is a pharmaceutical composition containing such a thionucleoside derivative or a salt thereof. 153
C07H 19/10 - Pyrimidine radicals with the saccharide radical being esterified by phosphoric or polyphosphoric acids
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
Provided are a polypeptide composition, which can induce a pluripotent stem cell culturing property, particularly, an excellent cell growth ability, and a culture method for pluripotent stern cells using the polypeptide composition. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. In the polypeptide composition, the amount of a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, is equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. The culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.
C12N 5/071 - Vertebrate cells or tissues, e.g. human cells or tissues
C07K 14/47 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans from vertebrates from mammals
The present invention addresses the problem of providing: a compound exhibiting excellent stability and/or solubility and the like, and further improved FLT3 inhibitory activity; and a pharmaceutical composition. The present invention provides a salt or crystal of (S,E)-N-(1-((5-(2-((4-cyanophenyl)amino)-4-(propylamino)pyrimidine-5-yl)pent-4-yne-1-yl)amino)-1-oxopropane-2-yl)-4-(dimethylamino)-N-methylbuto-2-enamide (compound A). This salt or crystal thereof exhibits excellent FLT3 inhibitory activity, and excellent properties as a drug such as storage stability, solubility, or the like; hence, said salt or crystal thereof is useful in treating a disease or a condition pertaining to FLT3. The present invention provides a pharmaceutical composition and an FLT3 inhibitor which contain this salt or the crystal thereof.
The present invention provides a compound represented by the formula (1) or a salt thereof, or a complex of the compound or the salt with a metal, in the formula (1), A1 represents a chelate group; R1 represents a hydrogen atom or the like; R2 represents a hydrogen atom or the like; and Z1, Z2, Z3, Z4, and Z5 are the same or different and each represent a nitrogen atom or CR2 or the like wherein R2 represents a hydrogen atom or an optionally substituted C1-6 alkyl group or the like; L1 represents a group represented by the formula (3) wherein R13, R14, R15, and R16 are the same or different and each represent a hydrogen atom or the like; L2 represents an optionally substituted C1-6 alkylene group; and L2 represents an optionally substituted C1-6 alkylene group.
C07D 401/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
A61K 31/555 - Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
C07F 5/00 - Compounds containing elements of Groups 3 or 13 of the Periodic System
49.
SYNTHETIC INTERMEDIATE OF 1-(2-DEOXY-2-FLUORO-4-THIO-.BETA.-D-ARABINOFURANOSYL)CYTOSINE, SYNTHETIC INTERMEDIATE OF THIONUCLEOSIDE, AND METHODS FOR PRODUCING THE SAME
A compound represented by a formula [1D] as shown below (wherein R1A, R1B, R2A, R2B, R3A and R3B represent a hydrogen atom, an optionally substituted C1- 6 alkyl group, and the like) is useful as an intermediate for producing a thionucleoside, and the production method of the present invention is useful as a method for producing a thionucleoside. (see above formula)
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
C07H 5/02 - Compounds containing saccharide radicals in which the hetero bonds to oxygen have been replaced by the same number of hetero bonds to halogen, nitrogen, sulfur, selenium, or tellurium to halogen
C07H 5/10 - Compounds containing saccharide radicals in which the hetero bonds to oxygen have been replaced by the same number of hetero bonds to halogen, nitrogen, sulfur, selenium, or tellurium to sulfur, selenium, or tellurium to sulfur
C07H 19/04 - Heterocyclic radicals containing only nitrogen as ring hetero atom
A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
The object is to provide an Fms-like tyrosine kinase 3 (FLT3) inhibitor useful as a therapeutic agent for acute myeloid leukemia (AML). A nitrogen-containing heterocyclic compound represented by the general formula [1] or a salt thereof is provided. The compound or a salt thereof of the present invention can be used as an active ingredient of a pharmaceutical composition for a treatment of a disease or a condition relating to FLT3, such as acute myeloid leukemia (AML) and acute promyelocytie leukemia (APL). (see formula 1)
C07D 213/74 - Amino or imino radicals substituted by hydrocarbon or substituted hydrocarbon radicals
A61K 31/505 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
A61K 31/506 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
A61K 31/5377 - 1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
A61K 31/55 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
A61K 31/551 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogens as ring hetero atoms, e.g. clozapine, dilazep
A61P 35/02 - Antineoplastic agents specific for leukemia
A61P 43/00 - Drugs for specific purposes, not provided for in groups
C07D 239/49 - Two nitrogen atoms with an aralkyl radical, or substituted aralkyl radical, attached in position 5, e.g. trimethoprim
C07D 401/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 401/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
C07D 403/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 405/12 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
52.
SALT OF 1-(2-DEOXY-2-FLUORO-4-THIO-.BETA.-D-ARABINOFURANOSYL)CYTOSINE
The problem of the present invention is to provide a superior anti-tumor agent. A salt of 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine is useful as the active ingredient of a medicine because it has at least one of characteristics such as the following: (1) excellent anti-tumor activity; (2) excellent crystallinity); (3) a high solubility in water; (4) not being deliquescent, (5) having excellent fluidity; (6) having excellent tableting properties; (7) being produced under environmentally friendly conditions; (8) being mass-produced.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
A superior antitumor agent is provided. A salt of 1-(2-deoxy-2-fluoro-4-thio-.beta.-D-arabinofuranosyl)cytosine shows at least one or more of such characteristics as (1) it has superior antitumor activity, (2) it shows superior crystallinity, (3) it shows high water solubility, (4) it does not show deliquescent property, (5) it shows superior flowability, (6) it shows superior tableting property, (7) it can be manufactured with less environmental load, and (8) it can be manufactured in a large scale, and therefore it is useful as a bulk drug for medicaments.
C07H 19/073 - Pyrimidine radicals with 2-deoxyribosyl as the saccharide radical
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
C30B 7/14 - Single-crystal growth from solutions using solvents which are liquid at normal temperature, e.g. aqueous solutions the crystallising materials being formed by chemical reactions in the solution
54.
FREEZING METHOD OF PRODUCING A POROUS POLYMERIC MATERIAL FROM A LIQUID SOLUTION
The invention relates to a method for producing a porous material from a liquid solution including a biocompatible polymer. In certain embodiments of the methods, the biocompatible polymer solution is optionally gelled, then frozen in a controlled fashion. The freezing optionally comprises steps that include: rapidly dropping the temperature to between -10°C and -50°C, so as to form a thin layer of frozen biocompatible polymer gel/solution on the thermally conducting surface; (ii) rapidly raising the temperature of the cooling device, to a temperature below sample Tm; (iii) lowering the temperature of the cooling device so as to induce a constant unidirectional growth rate of ice-crystals, then freeze drying the product.
Provided are a bone regeneration agent and a bone supplementation formulation which can accelerate bone regeneration by means of the actual supplement material carrier. The bone regeneration agent includes gelatin having an amino acid sequence derived from a partial amino acid sequence of collagen.
A heat generating body has a first electrode and a second electrode arranged opposed to each other, and also has a mesh-like electrically conductive membrane (mesh-like pattern) mounted in a curved surface shape between the first electrode and the second electrode. The first electrode and the second electrode are arranged so as to satisfy the relationship of (Lmax - Lmin)/((Lmax + Lmin)/2) <= 0.375, where Lmin is a minimum value of the distance between two opposite points which are on the first and second electrodes and on the electrically conductive membrane and Lmax is a maximum value of the distance.
A cartridge for photographic processing agents, which is formed of containers for photographic processing agents and a storage box for housing the containers in any selected dispositions in the box, in which at least one of the containers is provided with at least one recess on an outer side thereof, and at least one opening is formed on the storage box corresponding to the recess of the container housed in the storage box, and in which the cartridge having the recess in the container and the opening corresponding to recess in the storage box prevents the cartridge from being erroneously loaded to an automatic photo-processor; and a container for a photographic processing agent usable in the cartridge.
B65D 71/06 - Bundles of articles held together by packaging elements for convenience of storage or transport, e.g. portable segregating carrier for plural receptacles such as beer cans or pop bottles; Bales of material comprising a plurality of articles completely or mainly held together by packaging elements, e.g. under tension
B65D 77/04 - Articles or materials enclosed in two or more containers disposed one within another
patents
