Provided is a method for detecting progranulin, characterized by use of an antibody that specifically binds to the P domain or the G domain of progranulin, and an antibody that specifically binds to the E domain of progranulin.
Provided is a method for detecting progranulin, said method being characterized by using: an antibody that is bounded specifically to the P domain or the G domain of progranulin; and an antibody that is bounded specifically to the E domain of progranulin.
A61K 31/5377 - 1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 31/7072 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid having two oxo groups directly attached to the pyrimidine ring, e.g. uridine, uridylic acid, thymidine, zidovudine
The disclosure relates generally to methods of treating central nervous system disorders using (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane (i.e. centanafadine) or a pharmaceutically acceptable salt thereof. More particularly, the disclosure relates to treating conditions affected by monoamine neurotransmitters.
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
A61K 31/343 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide condensed with a carbocyclic ring, e.g. coumaran, bufuralol, befunolol, clobenfurol, amiodarone
The present invention relates to a pharmaceutical composition comprising (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane (centanafadine) or a pharmaceutically acceptable salt thereof as an active ingredient, and a formulation comprising the pharmaceutical composition, which can be administered once daily.
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
A61P 25/00 - Drugs for disorders of the nervous system
6.
SHORTENED POLYCYSTIN-1 POLYPEPTIDE AND USE THEREOF
The present disclosure includes: a polynucleotide comprising a sequence encoding shortened polycystin-1 (PC1) having a cyst formation-inhibiting activity, in which the shortened PC1 contains a PC1 C-terminal tail (CTT) domain or a part thereof; a shortened PC1 polypeptide encoded by the polynucleotide; a vector carrying the polynucleotide; a pharmaceutical composition for treating PKD1-related diseases, which contains the polynucleotide, the polypeptide or the vector; and others.
A61K 38/17 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans
A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
A61P 13/12 - Drugs for disorders of the urinary system of the kidneys
A61P 43/00 - Drugs for specific purposes, not provided for in groups
C12N 15/63 - Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
Disclosed is a solid dispersion that includes components (a), (b), and (c). (a) Delamanid, (b) at least one compound selected from the group that consists of polyvinyl caprolactam/polyvinyl acetate/polyethylene glycol graft copolymers and vinylpyrrolidone/vinyl acetate copolymers, and (c) at least one compound selected from the group that consists of hydroxypropyl methylcellulose phthalate and hydroxypropyl methylcellulose acetate succinate.
A61K 31/454 - Non-condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone
Provided herein are pharmaceutical compositions comprising a quinolone compound for irritable bowel syndrome, especially provided is the use of the quinolone compound, in particular 1-cyclopropyl-6-fluoro-1, 4-dihydro-8-methyl-7- (2-amino-3-cyano-5-pyridyl) -4-oxo-3-quinoline-carboxylic acid or a pharmacologically acceptable salt, a hydrate, a solvate or a deuteride thereof for preventing or treating irritable bowel syndrome of a human or an animal.
To develop a new tumor preventative/therapeutic. Provided are: an agent for preventing and/or treating a tumor, the agent containing, inter alia, an IKZF1ΔE5 protein, which is a deletion variant of IKZF1 in which part or all of exon 5 has been deleted, or an IKZF1ΔE5-gene-related substance; and a method for screening such agents.
A61K 45/00 - Medicinal preparations containing active ingredients not provided for in groups
A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
The present disclosure provides a method for determining whether or not a subject is suffering from synucleinopathy on the basis of a level of ApoA1 that is bonded to α-synuclein in a sample which has been taken from the subject.
C12Q 1/00 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
Provided are: a microorganism belonging to the genus Akkermansia, which has a 16S rRNA gene containing a nucleotide sequence having a homology exceeding 98.0% to the nucleotide sequence represented by SEQ ID NO: 3, etc., has NOD2 agonist activity, is capable of assimilating D-mannitol, is negative in Gram stain, is a spherical to short rod-shaped anaerobic bacterium, and is negative in oxidase test and positive in catalase test; and a microorganism including the aforesaid microorganism for activating NOD2, enhancing immunity, etc.
Disclosed are: a method for determining and/or guessing a mechanism of action of a compound in a living organism, the method involving analyzing the activity of a nerve cell under the presence of a compound of which a mechanism of action is known and a compound of which a mechanism of action is unknown, and, by comparing the analyzed results, determining and/or guessing the mechanism of action of the compound of which a mechanism of action is unknown in a living organism; and a method for screening an antiepileptic medicine, the method involving analyzing the activities of a nerve cell under the presence of a test material and a compound of which an antiepileptic action is known, and by comparing the analysis results, selecting the test material as a candidate material of the antiepileptic medicine when the test material has the same mechanism of action as the compound.
The present disclosure provides a wound treatment composition and the like. N-(\{2-[4-(difluoromethoxy)-3-(propan-2-yloxy)phenyl]-1,3-oxazol-4-yl\}methyl)-2-ethoxybenzamide or a salt thereof is useful as an active ingredient of the wound treatment composition.
[Problem] To provide a computer program and an information processing device and method that are used to estimate the health state of a user of interest on the basis of the history of actions performed by the user of interest, and that offer at least partially improved performance. [Solution] A computer program according to an embodiment is capable of "causing, by being executed by at least one processor, the at least one processor to function to: acquire action data of interest that identifies a history of actions performed by a user of interest; and input the action data of interest to an estimation model, which is generated by performing supervised learning, so as to cause the estimation model to output sleep state data of interest that identifies the sleep state of the user of interest, the sleep state data of interest including at least one of nature data of interest identifying the nature of the sleep of the user of interest, rhythm data of interest identifying the rhythm of the sleep of the user of interest, time data of interest identifying the sleep time of the user of interest, and category data of interest identifying the sleep category to which the user of interest belongs".
G16H 10/00 - ICT specially adapted for the handling or processing of patient-related medical or healthcare data
G16H 50/30 - ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for individual health risk assessment
15.
METHODS OF TREATING CANCER WITH IAP ANTAGONIST COMPOUNDS AND COMBINATION THERAPIES
BOARD OF REGENTS, THE UNIVERSITY OF TEXAS SYSTEM (USA)
Inventor
Sims, Martin John
Ward, George Albert
Smyth, Tomoko
Borthakur, Gautam
Abstract
The present disclosure relates generally to use of a compound of formula (I), also named ASTX660 in combination therapies for treating cancer, in particular leukemia.
A61K 31/5377 - 1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
A61K 31/573 - Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
A61K 31/635 - Compounds containing para-N-benzene- sulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonohydrazide having a heterocyclic ring, e.g. sulfadiazine
A61K 9/48 - Preparations in capsules, e.g. of gelatin, of chocolate
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
[Problem] Conventionally, it has been known that the production efficiency of platelets can be optimized by agitating contents under the agitation condition that the shear force index is a predetermined value. By utilizing this, the present invention is to optimize the production efficiency of platelets further by using a maximum speed and an actual mean speed when blades move. [Solution] The present invention is characterized in that: an agitation device comprises an agitation container in which contents for producing platelets are contained, an agitation means for agitating the contents in the agitation container by rotation or reciprocating movement, and a control device which includes a storage unit and a calculation unit and which controls the rotation or reciprocating movement of the agitation means; and a method comprises a first step for obtaining a set maximum speed determination function indicating the relationship between the set maximum speed of the agitation means and a shear force index, a second step for obtaining the set maximum speed from a value of the desired shear force index by using the set maximum speed determination function, and a third step for agitating contents in the agitation container on the basis of the set maximum speed.
C12M 1/02 - Apparatus for enzymology or microbiology with heat exchange means
B01F 27/93 - Mixers with rotary stirring devices in fixed receptacles; Kneaders with stirrers rotating about a substantially vertical axis with rotary discs
B01F 33/25 - Mixers with loose mixing elements, e.g. loose balls in a receptacle
18.
COMPOSITION FOR IMPROVING SLEEP QUALITY OR CONTROLLING AUTONOMIC NERVOUS SYSTEM
Provided is a novel means for improving sleep quality, etc. A composition for improving sleep quality that contains kaempferol and/or a glycoside thereof.
A23L 33/105 - Plant extracts, their artificial duplicates or their derivatives
A61K 31/352 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. cannabinols, methantheline
A61K 36/31 - Brassicaceae or Cruciferae (Mustard family), e.g. broccoli, cabbage or kohlrabi
A61P 25/02 - Drugs for disorders of the nervous system for peripheral neuropathies
Provided is a means by which a stable dihydrate crystal of 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one or a salt thereof can be efficiently produced. Specifically, a method for producing a dihydrate crystal of 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one or a salt thereof is provided, the method comprising (1) cooling an aqueous alcohol solution containing, dissolved therein, 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one and an alkali, (2) adding water to the cooled aqueous solution, and (3) leaving the solution to rest or stirring the solution for 10 minutes to 19 hours at a temperature that is higher than the cooling temperature.
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
21.
NOVEL CRYSTAL FORM OF BENZOTHIOPHENE COMPOUND AND PRODUCTION METHOD THEREFOR
Provided is a means by which a dihydrate stable crystal of 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one or a salt thereof can be efficiently produced. Specifically, provided is a method for producing a dihydrate crystal of 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one or a salt thereof, the method comprising: (1) cooling an alcohol aqueous solution in which 7-[4-(4-benzo[b]thiophen-4-yl-piperazin-1-yl)butoxy]-1H-quinolin-2-one and an alkali are dissolved; (2) further adding water to the cooled aqueous solution; and (3) leaving-alone or stirring the resultant for 10 minutes to 19 hours at a temperature higher than the cooling temperature.
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
Provided is an amorphous tolvaptan-containing composition, for preparing a suspension, that has good storage stability and that can be prepared at the time of use. More specifically, a composition for preparing a suspension, comprising (a) particles containing amorphous tolvaptan, (b) xanthan gum, and (c) benzoic acid or a salt thereof is provided.
A61K 31/55 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
Provided is a regulator of cell membrane scrambling (e.g., cell membrane scrambling induced by extracellular ATP stimulation), said regulator containing at least one regulator selected from the group consisting of XK expression regulators, XK function regulators, VPS13A expression regulators, and VPS13A function regulators.
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
A23L 33/00 - Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
Pyrrolidine compounds having an HDAC inhibition activity which are useful for treatment or prevention of diseases involving HDACs are provided. A compound of Formula [I], or a salt thereof, wherein R1is an optionally substituted 6- to 10-membered aryl, etc.; a ring structure A is any one of the formulae (A1) to (A3) wherein ring groups G1and G2are each independently 6- to 10-membered aryl or 5- to 10-membered heteroaryl, which is optionally substituted with oxo; m and n are each independently an integer of 1 or 2; R21, R22, and R231-61-6 alkyl, etc.; and p, q, and r are each independently an integer of 0 to 2.
C07D 401/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 401/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
C07D 403/06 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
C07D 403/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing three or more hetero rings
C07D 405/14 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing three or more hetero rings
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 409/14 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing three or more hetero rings
C07D 417/14 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing three or more hetero rings
A61K 31/4025 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil not condensed and containing further heterocyclic rings, e.g. cromakalim
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
A compound represented by formula [I] (in the formula, R12, R13, R14, R15and R161-61-61-6 alkoxy optionally substituted with halogen; R21, R22and R231-61-61-6 alkoxy optionally substituted with halogen, sulfanyl, nitro or cyano optionally substituted with halogen; R31-61-6 alkyl, etc.; and X- is an anion).
C07D 219/14 - Heterocyclic compounds containing acridine or hydrogenated acridine ring systems with hydrocarbon radicals, substituted by nitrogen atoms, attached to the ring nitrogen atom
B01J 31/02 - Catalysts comprising hydrides, coordination complexes or organic compounds containing organic compounds or metal hydrides
C07C 37/58 - Preparation of compounds having hydroxy or O-metal groups bound to a carbon atom of a six-membered aromatic ring by oxidation reactions introducing directly a hydroxy group on a CH-group belonging to a six-membered aromatic ring with the aid of molecular oxygen
One of the purposes of the present invention is to provide a novel method for producing a kidney organoid. Provided is a method for producing a kidney organoid, the method being characterized by including culturing an initial kidney organoid using a culture medium containing an RXR agonist and a PPAR agonist, and being also characterized by containing a mature proximal convoluted tubule cell.
This phytin has improved solubility in water. The present application provides a phytin that contains calcium and/or magnesium at a specific mole ratio with respect to phytic acid.
The present invention discloses administering a trinapant-type-drug-containing pharmaceutical composition in combination with a pharmaceutical composition that contains immune cells modified to express chimeric antigen receptors or recombinant T-cell receptors.
Provided is a technique by which a subject can be alerted to a prescribed disease or to a disability or the like associated with symptoms that do not correspond to a disease but do interfere with daily life. This information provision method includes: acquiring personal data of a target customer; determining a segmentation to which the target customer belongs from among a plurality of segmentations, each of which indicates a classification that corresponds to at least the degree of a health condition, on the basis of the personal data and classification criteria prepared in advance; and providing health information that corresponds to the determined segmentation to the target customer. The personal data is configured from a plurality of pieces of unique data relating to the target customer. At least one of the plurality of pieces of unique data is symptom data reflecting the health condition of the target customer. The plurality of segmentations are classified according to the degree of the health symptom, and each segmentation is associated with health information prepared in advance in accordance with the health condition.
G16H 20/00 - ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
30.
PRIMER SET FOR DETECTING CHIMERIC ANTIGEN RECEPTOR
Provided is a therapeutic agent for ADHD having an efficacy comparable to that of central nervous system stimulants and the same low risk of drug dependence and abuse as existing non-central nervous system stimulants, more particularly a compound represented by formula [I]: wherein each symbol is as defined in the description, or a salt thereof.
C07D 241/36 - Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings condensed with carbocyclic rings or ring systems
C07D 405/12 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
A61P 25/00 - Drugs for disorders of the nervous system
A61K 31/498 - Pyrazines or piperazines ortho- or peri-condensed with carbocyclic ring systems, e.g. quinoxaline, phenazine
A23L 33/11 - Plant sterols or derivatives thereof, e.g. phytosterols
A61K 31/352 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. cannabinols, methantheline
A23L 33/11 - Plant sterols or derivatives thereof, e.g. phytosterols
A61K 31/352 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. cannabinols, methantheline
A61P 21/00 - Drugs for disorders of the muscular or neuromuscular system
C07D 209/52 - Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring condensed with a ring other than six-membered
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
A61P 25/00 - Drugs for disorders of the nervous system
C07D 405/12 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
36.
PYRAZOLO[1,5-A]PYRIMIDINE COMPOUND FOR THE TREATMENT OF DERMAL DISORDERS
Provided is a pyrazolo[1,5-a]pyrimidine compound represented by the general formula [I]: wherein each symbol is as defined in the description, or a salt thereof, having PAR2 inhibitory activity, and a pharmaceutical composition comprising the same.
In an aspect, the present invention is directed to an injection device. The injection device includes a pneumatic piston chamber and a pneumatic piston slidably positioned within the pneumatic piston chamber; a dose chamber and an injectate piston slidably positioned within the dose chamber; and an injection completion indicator comprising a window into the piston chamber or dose chamber, wherein the injection completion indicator is aligned with a portion of the pneumatic piston chamber or the dose chamber. In another aspect, the present invention is directed to a method of administering an injection to a subject using the injection device of the invention.
A61M 5/48 - Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm rests having means for varying, regulating, indicating or limiting injection pressure
A61M 5/50 - Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm rests having means for preventing re-use, or for indicating if defective, used, tampered with or unsterile
A61M 5/30 - Syringes for injection by jet action, without needle, e.g. for use with replaceable ampoules or cartridges
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
The invention provides DNA damage response (DDR) pathway genes and their gene products as biomarkers to predict effective treatment of cancer using an MDM2 antagonist. Identifying one or more DDR pathway biomarkers in a cancer patient allows a determination to be made whether the patient's cancer is likely to be successfully treated using an MDM2 antagonist. Accordingly, the invention relates generally to a companion diagnostic for MDM2 antagonist therapy. In particular, the DDR pathway comprises one or more genes from: the homologous recombination repair (HRR) pathway; the non-homologous end joining (NHEJ) pathway; the mismatch repair (MMR) pathway; the Fanconi Anemia (FA) pathway; and/or the base excision repair (BER) pathway.
C12Q 1/6886 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
39.
CENTANAFADINE PHARMACEUTICAL FORMULATIONS, AND METHODS OF MAKING AND USING SAME
Pharmaceutical formulation comprising centanafadine (CTN) or a pharmaceutically acceptable salt thereof and an excipient, and related methods of manufacture and use, are disclosed.
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
A61P 25/26 - Psychostimulants, e.g. nicotine, cocaine
40.
AMORPHOUS MATERIAL AND COMPOSITION CONTAINING SAID AMORPHOUS MATERIAL
The present invention provides: an amorphous solid dispersion which contains a compound (I); an amorphous material (amorphous substance) which contains the compound (I) and an organic acid; an amorphous solid dispersion which contains this amorphous material; a pharmaceutical composition which contains this amorphous material or this amorphous solid dispersion; preparation methods thereof; and the like.
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
An amorphous solid dispersion containing compound (I); an amorphous form comprising compound (I) and an organic acid; an amorphous solid dispersion containing the amorphous form; a medicinal composition containing the amorphous form or amorphous solid dispersion; and methods for producing these.
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
42.
COMPOSITION FOR PREVENTING OR TREATING DETERIORATION IN BRAIN FUNCTION OR MAINTAINING OR IMPROVING BRAIN FUNCTION
The present invention addresses the problem of providing: a method for evaluating dementia; and a composition for preventing or treating deterioration in brain function, or maintaining or improving brain function. The intestinal microflora of healthy people, people with mild cognitive impairment, or patients suffering from Alzheimer's disease were compared. As a result, a microorganism belonging to the genus Faecalibacterium was selected as an intestinal microorganism associated with cognitive function. Furthermore, it has been found that Faecalibacterium prausnitzii having a specific DNA exhibits an effect of ameliorating brain function deterioration such as learning and memory impairment.
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
C12Q 1/02 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
C12Q 1/04 - Determining presence or kind of microorganism; Use of selective media for testing antibiotics or bacteriocides; Compositions containing a chemical indicator therefor
Provided according to embodiments of the invention are methods of treating a disorder in a subject in need thereof that include administering to the subject an effective amount of cedazuridine, an effective amount of decitabine, and an effective amount of venetoclax, thereby treating the disorder in the subject. In some embodiments of the invention, the disorder is a hyperproliferative disorder such as a cancer. In some embodiments, the disorder is a hematological cancer such as myelodysplastic syndromes (MDS), myeloproliferative neoplasms (MPN), leukemia (e.g., acute myeloid leukemia), or lymphoma.
A61P 35/02 - Antineoplastic agents specific for leukemia
A61K 31/635 - Compounds containing para-N-benzene- sulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonohydrazide having a heterocyclic ring, e.g. sulfadiazine
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 31/136 - Amines, e.g. amantadine having aromatic rings, e.g. methadone having the amino group directly attached to the aromatic ring, e.g. benzeneamine
A61K 31/445 - Non-condensed piperidines, e.g. piperocaine
A61K 31/453 - Non-condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with oxygen as a ring hetero atom
Provided is a means that is useful for imparting kaempferol-induced physiological effects. A plant extract according to the present invention contains 1 mg/g or more of kaempferol aglycone in terms of dry weight.
C07D 311/30 - Benzo [b] pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3 with aromatic rings attached in position 2 only not hydrogenated in the hetero ring, e.g. flavones
A61K 31/352 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. cannabinols, methantheline
A61K 36/31 - Brassicaceae or Cruciferae (Mustard family), e.g. broccoli, cabbage or kohlrabi
The invention provides SKP2 as a biomarker to predict effective treatment of cancer using an MDM2 antagonist. Identifying this biomarker in a cancer patient allows a determination to be made whether the patient's cancer is likely to be successfully treated using an MDM2 antagonist. Accordingly, the invention relates generally to a companion diagnostic for MDM2 antagonist therapy. The SKP2 biomarker may be measured directly, or indirectly by detection of a molecule that is functionally upstream or downstream of SKP2 and the level of which correlates with the level of the SKP2 biomarker, such as the detection of one or more SKP2 substrates.
C12Q 1/6886 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
An object of the present invention is to provide a crystal of compound 1, which is useful as an antitumor agent, the crystal being stable, excellent in oral absorbability, highly chemically pure, and suitable for mass production. The present invention provides a crystal of compound 1 that exhibits an X-ray powder diffraction spectrum containing, at diffraction angles 2θ±0.2°, characteristic peaks of at least 3 characteristic peaks selected from the group consisting of 5.8°, 9.8°, 12.2°, 14.0°, 15.3°, 21.1°, and 27.6°.
C07D 519/00 - Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups or
A purpose of the present invention is to provide a ventral retrointestinal organoid for producing a bladder organoid having a layered structure of a bladder epithelial cell type, similar to that of a bladder. An embodiment of the present invention provides a method for producing a ventral retrointestinal organoid, including: culturing pluripotent stem cells using an induction medium A containing activin A and a GSK3β inhibitor and inducing differentiation into embryonic endoderm cells; and culturing the embryonic endoderm cells using an induction medium B that contains a fibroblast growth factor and a GSK3β inhibitor and may further contain a bone morphogenetic protein, then culturing the embryonic endoderm cells, in the presence of an extracellular matrix, in the induction medium B that contains a fibroblast growth factor and a GSK3β inhibitor and may further contain a bone morphogenetic protein, and forming a ventral retrointestinal organoid.
Provided is a method for measuring sucrase activity of a subject sucrase/isomaltase complex, wherein: the method includes calculating, as the measured value of sucrase activity, the ratio of the quantity of 132222 in a test sample, where the test sample is exhaled breath discharged from a subject to whom 13C-labeled sucrose has been orally administered; at least one carbon atom of the fructose portion of the 13C-labeled sucrose is labeled with 13C, and the carbon atoms of the glucose portion are not labeled with 13C; and the test sample is collected at a time determined on the basis of a period in which the aforementioned ratio is equal in a healthy group and a group having reduced glucose metabolic capacity. Also provided is a method for diagnosing sucrase-related disease through use of the aforementioned method.
This method for producing an organoid from lung epithelial cells or lung cancer cells includes culturing a specimen containing lung epithelial cells or lung cancer cells in a culture medium. The culture medium includes: 0-10%v/v of extracellular matrix; and a combination of at least one selected from the group consisting of keratinocyte growth factor (KGF), fibroblast growth factor (FGF) 10 and hepatocyte growth factor (HGF), a bone morphogenetic protein (BMP) inhibitor, and TGF-β inhibitor. The culture medium substantially does not include feeder cells.
The present invention provides: a novel active pharmaceutical ingredient form of 5-{[(3R,4R)-1-(4-chloro-2,6-difluorophenyl)-3,4-dihydroxypiperidin-4-yl]methoxy}-8-fluoro-3,4-dihydroquinolin-2(1H)-one (compound A); a medication containing same; and a production method thereof. The present invention pertains to a cocrystal of compound A and a coformer, or to a cocrystal solvate thereof.
C07D 401/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
A61K 31/4709 - Non-condensed quinolines containing further heterocyclic rings
The present disclosure is directed to the methods of treating a patient with schizophrenia or bipolar I disorder by administering to the patient an injectable preparation of aripiprazole, wherein the patient is administered the injectable preparation about once every two months.
The present disclosure is directed to a method of dose initiation for an aripiprazole treatment to a patient in need thereof; the patient is administered two, separate 100 to 500 mg injections of an aripiprazole intramuscular (IM) depot formulation at separate gluteal and/or deltoid injection sites, and a single dose of oral aripiprazole. The administration occurs on a first day of the treatment.
A61K 31/496 - Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene
A61P 25/18 - Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
53.
GENETICALLY MODIFIED MEGAKARYOCYTE, MODIFIED PLATELET, AND METHODS RESPECTIVELY FOR PRODUCING SAID GENETICALLY MODIFIED MEGAKARYOCYTE AND SAID MODIFIED PLATELET
Provided is a method for producing a genetically modified megakaryocyte, the method comprising a step for introducing a CRISPR-associated (Cas) family protein and guide RNA (gRNA) into a megakaryocyte to modify a gene of interest, wherein the Cas family protein and the gRNA to be introduced into the megakaryocyte at said step are formed as a complex beforehand. The method is useful as a technique for producing a genetically modified megakaryocyte and a modified platelet.
Embodiments of the present invention provide solid oral dosage forms that upon daily administration to a subject provide plasma levels of decitabine with a 5-day AUC for decitabine that is equivalent to the 5-day AUC for a daily IV dose of decitabine of 20 mg/m2administered as a one hour (1 h) infusion. Also provided according to embodiments of the present invention are solid oral dosage forms wherein upon daily administration to a subject provides a pharmacodynamic effect that is equivalent to the pharmacodynamic effect for a daily intravenous dose of decitabine of 20 mg/m2 administered as a one hour (1 h) infusion. Also provided are methods of treatment using a solid oral dosage form according to an embodiment of the invention.
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
55.
NOVEL MEDICAMENT FOR TREATING HEPATIC ENCEPHALOPATHY
The present invention relates to a medicament for treating and/or preventing hepatic encephalopathy, comprising a quinolone compound as an active ingredient.
A61K 31/4709 - Non-condensed quinolines containing further heterocyclic rings
A61P 1/16 - Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
A61P 25/00 - Drugs for disorders of the nervous system
56.
NOVEL MEDICAMENT FOR TREATING INFLAMMATORY DISEASE
The present invention relates to a medicament for treating and/or preventing inflammatory disease, comprising a quinolone compound as an active ingredient.
A61K 31/4709 - Non-condensed quinolines containing further heterocyclic rings
A61P 1/00 - Drugs for disorders of the alimentary tract or the digestive system
A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
The present invention provides a combination drug for the treatment of a malignant tumor comprising 2-((1R,2R,4S)-2-amino-7-azabicyclo[2.2.1]heptan-7-yl)-5-(3,4-dichloro-2-methyl-2H-indazol-5-yl)-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one or a pharmaceutically acceptable salt thereof, and at least one additional compound having an antitumor effect or at least one pharmaceutically acceptable salt thereof, and a pharmaceutical composition comprising both the active ingredients.
The invention provides biomarkers to predict effective treatment of cancer using an MDM2 antagonist. Identifying one or more of these biomarkers in a cancer patient allows a determination to be made whether the patient's cancer is likely to be successfully treated using an MDM2 antagonist. Accordingly, the invention relates generally to a companion diagnostic for MDM2 antagonist therapy. The biomarkers are: (i) BAP1; and/or (ii) CDKN2A; and/or (iii) one, two, three, four, five, six, seven, eight, nine, ten or more of: CXCL10, CXCL11, RSAD2, MX1, BATF2, IFI44L, IFITM1, ISG15, CMPK2, IFI27, CD74, IFIH1, CCRL2, IFI44, HERC6, ISG20, IFIT3, HLA-C, OAS1, IFI35, IRF9, EPSTI1, USP18, BST2, CSF1, C1S, DHX58, TRIM14, OASL, IRF7, LGALS3BP, DDX60, LAP3, LAMP3, PARP12, PARP9, SP110, PLSCR1, WARS, STAT1, IRF3, IRF5, MSC, JUN, SPI1, IRF1, COMMD3-BMI1, STAT2, RUNX3, SREBF1, FLI1 and BRCA1.
Provided is an acrylamide compound, which is useful for the promotion of platelet production from platelet progenitor cells such as megakaryocytes in vitro and represented by general formula [I]:wherein each symbol is as defined in the description.
C07D 209/22 - Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with an aralkyl radical attached to the ring nitrogen atom
C07D 235/06 - Benzimidazoles; Hydrogenated benzimidazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached in position 2
C07D 401/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 401/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
C07D 403/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 405/12 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 409/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 413/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
C07D 417/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
A61K 31/437 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a five-membered ring having nitrogen as a ring hetero atom, e.g. indolizine, beta-carboline
A61K 31/444 - Non-condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring hetero atom, e.g. amrinone
A61K 31/427 - Thiazoles not condensed and containing further heterocyclic rings
A61K 31/422 - Oxazoles not condensed and containing further heterocyclic rings
A61K 31/416 - 1,2-Diazoles condensed with carbocyclic ring systems, e.g. indazole
A61K 31/405 - Indole-alkanecarboxylic acids; Derivatives thereof, e.g. tryptophan, indomethacin
The present disclosure pertains to an anti-hGDF15 antibody that binds to an epitope of hGDF15 including an amino acid sequence of DHCPLGPGRCCRLH (SEQ ID NO: 3), and pertains to applications thereof, etc.
A61K 39/395 - Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
C07K 16/24 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
C12N 1/15 - Fungi ; Culture media therefor modified by introduction of foreign genetic material
C12N 1/19 - Yeasts; Culture media therefor modified by introduction of foreign genetic material
C12N 1/21 - Bacteria; Culture media therefor modified by introduction of foreign genetic material
The present disclosure includes: an anti-hGDF15 antibody capable of bonding to an epitope of hGDF15 which comprises the amino acid sequence DHCPLGPGRCCRLH (SEQ ID NO: 3); a use of the antibody; and others.
A61K 39/395 - Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
C07K 16/24 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
C12N 1/15 - Fungi ; Culture media therefor modified by introduction of foreign genetic material
C12N 1/19 - Yeasts; Culture media therefor modified by introduction of foreign genetic material
C12N 1/21 - Bacteria; Culture media therefor modified by introduction of foreign genetic material
Provided is an orally disintegrating tablet that contains brexpiprazole or a salt thereof, has a hardness suitable for practical use, and rapidly disintegrates in the oral cavity. More specifically, provided is an orally disintegrating tablet which contains (A) brexpiprazole or a salt thereof, (B) D-mannitol, (C) a partially pregelatinized starch, and (D) a lubricant.
Provided is an orally disintegrating tablet that quickly disintegrates in the oral cavity while having practical hardness, the orally disintegrating tablet containing brexpiprazole or a salt thereof. More specifically, provided is an orally disintegrating tablet containing (A) brexpiprazole or a salt thereof, (B) D-mannitol, (C) partially pregelatinized starch, and (D) a lubricant.
The present invention addresses the problem of finding a method for reliably producing (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane hydrochloride, wherein crystalline polymorphs can be controlled with industrially easy operations. Provided is a method for producing a crystalline form of (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane hydrochloride, the method comprising: step (a) for heating and dissolving (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane hydrochloride in a solvent including an alcohol-based solvent; step (b) for cooling the dissolved product of step (a) to a temperature, at which crystals of (1R,5S)-1-(naphthalen-2-yl)-3-azabicyclo[3.1.0]hexane hydrochloride precipitate, to nucleate the crystals; step (c) for heating a mixture containing the crystals obtained by nucleation to a temperature at which only a specific crystalline form selectively remains; and step (d) for cooling the mixture heated in step (c) to obtain the crystalline form.
A61P 25/00 - Drugs for disorders of the nervous system
A61P 43/00 - Drugs for specific purposes, not provided for in groups
C07D 209/52 - Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring condensed with a ring other than six-membered
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
66.
2'-DEOXY-2',2'-DIFLUOROTETRAHYDROURIDINES WITH HIGH PURITY AND METHODS OF MAKING THE SAME
The invention relates to methods of synthesizing 2'-deoxy-2',2'-difluorotetrahydrouridine with increased purity and uniform particle size distribution. In particular, methods of the invention include crystallization and isolation procedures rendering synthetic reaction intermediates. The invention further includes compositions comprising the final compound in highly pure form, including lower number of impurities and lower levels of individual and total impurities.
The invention provides new pyrazine derivatives of formula (I): or a tautomer or a solvate or a pharmaceutically acceptable salt thereof, wherein the substituents are as defined herein. The invention also provides pharmaceutical compositions comprising said compounds and to the use of said compounds in the treatment of diseases, e.g. cancer.
Provided is a means that can prevent an initial excessive release of an effective ingredient, and enables a sustained release of the effective ingredient at a therapeutically effective amount over a long period of time.
Provided is a means that can prevent the initial excessive release of an active ingredient and sustainedly release said active ingredient in a therapeutically effective amount over a long period of time.
The present invention provides a means that can prevent excessive release of an active ingredient at an initial stage and that is capable of releasing the active ingredient in a sustained manner over a long period of time at a therapeutic effective dose.
nn-time periods into the future, determining a plurality of boundaries around the central tendency, determining based on the data represented by the one or more data structures, an current observed adherence volatility metric, determining whether the current observed adherence volatility metric satisfies at least one of the plurality of boundaries around the central tendency, and based on a determination that the current observed adherence volatility metric satisfies at least one of the plurality of boundaries around the central tendency, generating a candidate anomaly data log record, the candidate anomaly data log record including data indicating that a candidate anomaly has been detected.
G16H 20/10 - ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance relating to drugs or medications, e.g. for ensuring correct administration to patients
G16H 50/20 - ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for computer-aided diagnosis, e.g. based on medical expert systems
72.
A DYNAMICALLY DISTORTED TIME WARPING DISTANCE MEASURE BETWEEN CONTINUOUS BOUNDED DISCRETE-TIME SERIES
Methods, systems, and computer programs for predicting an entity's adherence or non- adherence to a regimen. A method includes accessing observed attributes of an entity during a first time duration, accessing historical data describing attributes of another entity, where the historical data was previously obtained during respective second time durations, for each of the other entities, that are each equal in duration to the first time duration, filtering the historical data to only include historical data describing attributes of at least one other entity that satisfy a similarity threshold, the similarity threshold defining a relationship between the observed attributes and the historical data based on a distorted distance measure, collapsing the remaining historical data into one or more representative data, and for each representative data series, generating a similarity based prediction related to an outcome for the entity based on (i) the observed data and (ii) the representative data attributes.
G06Q 10/04 - Forecasting or optimisation specially adapted for administrative or management purposes, e.g. linear programming or "cutting stock problem"
G16H 20/00 - ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
73.
TETRA-FUNCTIONAL CHEMICAL PROBE AND METHOD FOR IDENTIFYING TARGET MEMBRANE PROTEIN FROM LIVING CELL OR LIVING TISSUE BY USING SAID PROBE
This tetra-functional compound is formed by linking, via a spacer as needed, a ligand binding site (A) or a ligand, a reactive site (D), a potential cleavage site (E), and a biotin site (B), wherein: the ligand binding site (A) is an active functional group such as an amine reactive group or a reactive functional group such as -COOH; the reactive site (D) is a group having a structure of a compound such as 2-aryl-5-carboxy-tetrazole; the potential cleavage site (E) is a group having a structure of a compound such as 1-(4 4-dimethyl-2 6-dioxocyclohex-1-ylidene)ethyl; and the spacer is a group obtained by substitution with a cross-linking group such as a linear or branched alkylene group having 1 or more carbon atoms.
Disclosed herein is a method for treating cancer with DNA-hypomethylating agents. Also disclosed herein is a method of selecting a treatment for a subject. Treatment can be given to a subject for more than one cycle of treatment to obtain improved efficacy of the treatment.
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
A61K 31/7084 - Compounds having two nucleosides or nucleotides, e.g. nicotinamide-adenine dinucleotide, flavine-adenine dinucleotide
The present disclosure provides an O/W-type emulsion composition which contains adenosine phosphate and/or a salt thereof, an acrylic acid-alkyl methacrylate copolymer, oil, and water, further contains a water‐soluble polymer selected from a swelling-type thickener, an association-type thickener, a polysaccharide and a derivative thereof, and a mixture thereof and/or a pH adjuster that is an organic alkali, and has a viscosity of less than 10,000 mPa∙s.
A61K 8/81 - Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions involving only carbon-to-carbon unsaturated bonds
The present invention provides an O/W-type emulsion composition containing adenosine phosphate and/or a salt thereof, an acrylic acid/alkyl methacrylate copolymer, an oil, and water, whereof the viscosity is 10,000 mPa·s or higher, and containing: a water-soluble polymer selected from a swelling-type thickener, an associating-type thickener, a polysaccharide and a derivative thereof, and a mixture thereof; and/or a pH adjuster that is an organic alkali.
A61K 8/81 - Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions involving only carbon-to-carbon unsaturated bonds
The present disclosure provides an O/W type emulsion composition which contains adenosine phosphate and/or a salt thereof, an acrylic acid/alkyl methacrylate copolymer, an oily component and water together with a water-soluble polymer, said water-soluble polymer being selected from among a swellable thickener, an associative thickener, a polysaccharide, a derivative thereof and a mixture of the same, and/or a pH adjusting agent, said pH adjusting agent being an organic alkali, and which has a viscosity of lower than 10,000 mPa·s.
A61K 8/81 - Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions involving only carbon-to-carbon unsaturated bonds
The present invention provides an O/W emulsion composition which has a viscosity of 10,000 mPa∙s or more, and which contains adenosine phosphate and/or a salt thereof, alkyl acrylate/methacrylate copolymer, an oil component and water, while additionally containing a water-soluble polymer that is selected from among swellable thickening agents, associated thickening agents, polysaccharides, derivatives of polysaccharides and mixtures of these substances, and/or a pH adjusting agent that is an organic alkali.
A61K 8/81 - Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions involving only carbon-to-carbon unsaturated bonds
The present invention is directed to a needle retention assembly, an injectate delivery system, a needle, and a safety mechanism, all of which are for use with an injection device. The needle retention assembly includes a needle offset nut which is configured to removably attach to a needle retention nut and to provide support to the needle. The injectate delivery system includes an injectate holding compartment, a plunger, and a resilient member. The needle has a sidewall defining a longitudinal channel and includes at least two orifices in the sidewall, but does not include an orifice at a tip of the needle. The safety mechanism includes a dual switch that includes two switch elements that are each positioned on opposing sides of a handle of the injection device.
A61M 5/315 - Pistons; Piston-rods; Guiding, blocking or restricting the movement of the rod; Appliances on the rod for facilitating dosing
A61M 5/32 - Syringes - Details - Details of needles pertaining to their connection with syringe or hub; Accessories for bringing the needle into, or holding the needle on, the body; Devices for protection of needles
A61M 5/34 - Constructions for connecting the needle
A61M 5/48 - Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm rests having means for varying, regulating, indicating or limiting injection pressure
An object is to provide a novel combination of antitumor agents that can significantly shrink tumors by synergistic antitumor action without increasing side effects as much as possible. Provided is an antitumor composition comprising the following compound (B) or a salt thereof for use in combination with the following antitumor agent (A): (A) at least one antitumor agent selected from the group consisting of alkylating agents, CD20 recognition molecules, DNA methylation inhibitors, pyrimidine antimetabolites, purine antimetabolites, antifolates, Bcl-2 inhibitors, and tyrosine kinase inhibitors; (B) a compound or a salt thereof represented by the following formula (1): wherein R1represents a halogen atom, an aryl group, an aryloxy group, or a lower alkyl group optionally substituted with one or more halogen atoms; R2represents a hydrogen atom, a halogen atom, a lower alkyl group, or a lower alkoxy group; and m represents an integer of 1 to 3, provided that when m represents 2 or 3, R1 is the same or different.
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
A61K 31/4184 - 1,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
A61K 31/175 - Amides, e.g. hydroxamic acids having the group N—C(O)—N or N—C(S)—N, e.g. urea, thiourea, carmustine having the group , N—C(O)—N=N— or , e.g. carbonohydrazides, carbazones, semicarbazides, semicarbazones; Thioanalogues thereof
A61K 31/255 - Esters, e.g. nitroglycerine, selenocyanates of sulfoxy acids or sulfur analogues thereof
A61K 31/675 - Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
A61K 31/198 - Alpha-amino acids, e.g. alanine, edetic acid (EDTA)
A61K 31/7008 - Compounds having an amino group directly attached to a carbon atom of the saccharide radical, e.g. D-galactosamine, ranimustine
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 31/7068 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
A61K 31/513 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
A61K 31/635 - Compounds containing para-N-benzene- sulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonohydrazide having a heterocyclic ring, e.g. sulfadiazine
A61K 31/517 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
A61K 31/519 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
A61K 31/4439 - Non-condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
A61K 31/5377 - 1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
A formulation stably comprising a tolvaptan prodrug is provided. Specifically, a freeze-dried composition comprising a compound represented by Formula (1) or a metal salt thereof and a disaccharide is provided.
A means for reducing side effects of tolvaptan is provided. Specifically, the means provides a pharmaceutical composition comprising a compound represented by Formula (1) or a metal salt thereof, wherein the pharmaceutical composition is used such that the compound represented by Formula (1) or a metal salt thereof is transvascularly administered in an amount of 4 to 20 mg over a period of 10 minutes or more.
A61K 31/675 - Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
A61P 1/16 - Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
A61P 9/04 - Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
A61P 13/12 - Drugs for disorders of the urinary system of the kidneys
The present invention relates to a method for monodeuterated lower alkylating an amine moiety of a compound which contains an amine that is protected by an aralkyl group, wherein a monodeuterated lower alkyl is introduced into the amine by means of a deuterated lower alkylating agent under neutral or basic conditions, and subsequently the aralkyl group is eliminated.
C07B 59/00 - Introduction of isotopes of elements into organic compounds
C07C 253/30 - Preparation of carboxylic acid nitriles by reactions not involving the formation of cyano groups
C07D 207/09 - Radicals substituted by nitrogen atoms not forming part of a nitro radical
C07D 207/267 - 2-Pyrrolidones with only hydrogen atoms or radicals containing only hydrogen and carbon atoms directly attached to other ring carbon atoms with only hydrogen atoms or radicals containing only hydrogen and carbon atoms directly attached to the ring nitrogen atom
C07D 211/46 - Oxygen atoms attached in position 4 having a hydrogen atom as the second substituent in position 4
C07D 225/02 - Heterocyclic compounds containing rings of more than seven members having one nitrogen atom as the only ring hetero atom not condensed with other rings
C07D 243/08 - Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4 not condensed with other rings
C07D 401/04 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring- member bond
C07D 403/06 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
C07D 209/08 - Indoles; Hydrogenated indoles with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, directly attached to carbon atoms of the hetero ring
C07D 295/03 - Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms containing only hydrogen and carbon atoms in addition to the ring hetero elements containing only one hetero ring with the ring nitrogen atoms directly attached to acyclic carbon atoms
C07D 205/04 - Heterocyclic compounds containing four-membered rings with one nitrogen atom as the only ring hetero atom not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
C07D 241/08 - Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having one or two double bonds between ring members or between ring members and non-ring members with oxygen atoms directly attached to ring carbon atoms
C07D 241/42 - Benzopyrazines with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the hetero ring
C07D 241/44 - Benzopyrazines with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to carbon atoms of the hetero ring
84.
METHODS AND APPARATUS FOR A FRAME SURROUNDING A WEARABLE PATCH
In some embodiments, a system includes a patch assembly and a frame. The patch assembly includes an adhesive portion. The patch assembly is configured to be coupled to a surface of a user via the adhesive portion. The patch assembly has a first patch configuration and a second patch configuration. The frame defines an opening. The patch assembly is configured to be disposed within the opening. The frame has a first frame configuration in which the frame is coupled to the patch assembly via a group of connectors such that the frame prevents the patch assembly from transitioning between the first patch configuration and the second patch configuration. The frame has a second frame configuration in which the group of connectors are broken and the frame is separated from the patch assembly.
In some embodiments, a system includes a patch assembly, a frame, and a conductive component. The patch assembly is configured to be coupled to a patient via an adhesive portion. The patch assembly includes an electronics subassembly. The frame has a first frame configuration in which the frame is coupled to the patch assembly via a plurality of connectors and a second frame configuration in which the plurality of connectors are broken and the frame is separated from the patch assembly. The conductive component forms a continuous loop when the frame is in the first frame configuration. A portion of the conductive component is broken when the frame is in the second frame configuration such that the conductive component is discontinuous between the first end and the second end. The portion of the conductive component is at least partially disposed on a connector from the plurality of connectors when the frame is in the first frame configuration.
The present invention provides an exercise-efficiency-improving composition, a fatigue-reducing composition, and a dynamic visual acuity-improving composition characterized by containing a plant-derived extract and/or a plant-derived processed product.
A61K 31/352 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. cannabinols, methantheline
A61K 35/644 - Beeswax; Propolis; Royal jelly; Honey
A method for producing an alkali metal salt or alkaline earth metal salt of a phosphate compound represented by formula (1): the method comprising a step of subjecting a compound represented by formula (2): a phosphorus oxyhalide, and one or more members selected from alkali metal hydroxides and alkaline earth metal hydroxides to a telescoping continuous reaction.
In some embodiments, a system includes a first assembly, a second assembly, and a connecting member. The first assembly includes a first electrode and a first adhesive portion. The first assembly is configured to be coupled to a surface of a patient via the first adhesive portion. The second assembly includes a second electrode and a second adhesive portion. The second assembly is configured to be coupled to the surface of the patient via the second adhesive portion. The connecting member has a first end coupled to the first assembly and a second end coupled to the second assembly. The connecting member is configured to transition between a first configuration and a second configuration and may be configured to be coupled to the surface of the patient via a third adhesive portion in both the first configuration and the second configuration.
The present invention provides a novel heterocyclic compound represented by Formula [I] and a salt thereof: wherein the symbols are as defined in the specification, which is useful for treating, preventing and/or diagnosing seizure and the like in disease involving epileptic seizure or convulsive seizure (including multiple drug resistant seizure, refractory seizure, acute symptomatic seizure, febrile seizure and status epilepticus), as well as a medical use therefor.
C07D 239/54 - Two oxygen atoms as doubly bound oxygen atoms or as unsubstituted hydroxy radicals
C07D 401/04 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring- member bond
C07D 403/04 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings directly linked by a ring-member-to-ring- member bond
C07D 405/04 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings directly linked by a ring-member-to-ring- member bond
C07D 413/04 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring- member bond
C07D 417/04 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing two hetero rings directly linked by a ring-member-to-ring- member bond
Provided is a novel heterocyclic compound having an aryl hydrocarbon receptor antagonist activity and useful for the promotion of platelet production, the compound being represented by the general formula [I]: wherein ring A, ring B, R1, R2, R3, R4, n, and X are as defined above, or a salt thereof.
The present invention relates to a medicament for treating and/or preventing inflammatory bowel disease, comprising a quinolone compound of the formula shown below as an active ingredient.
A61K 31/497 - Non-condensed pyrazines containing further heterocyclic rings
A01N 43/90 - Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having two or more relevant hetero rings, condensed among themselves or with a common carbocyclic ring system
A61P 1/00 - Drugs for disorders of the alimentary tract or the digestive system
A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
C07D 519/00 - Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups or
A61K 31/519 - Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
A61P 43/00 - Drugs for specific purposes, not provided for in groups
C07D 451/02 - Heterocyclic compounds containing 8-azabicyclo [3.2.1] octane, 9-azabicyclo [3.3.1] nonane, or 3-oxa-9-azatricyclo [3.3.1.02,4] nonane ring systems, e.g. tropane or granatane alkaloids, scopolamine; Cyclic acetals thereof containing not further condensed 8-azabicyclo [3.2.1] octane or 3-oxa-9-azatricyclo [3.3.1.02,4] nonane ring systems, e.g. tropane; Cyclic acetals thereof
[Problem] The present invention addresses the problem of developing technology that makes it possible to evaluate, objectively and with excellent repeatability, the state of aging and the development and progression of a given disease, in particular, of providing a method for detecting conjunctival diseases such as conjunctival MALT lymphoma and providing a biomarker for aging that serves as an indicator of the state of aging. [Solution] A conjunctival disease detection method using ocular surface tissue, wherein the conjunctival disease detection method includes a step for comparing the microbial community structure of the microbiota included in an ocular surface tissue specimen collected from a healthy individual and the microbial community structure of the microbiota included in an ocular surface tissue specimen collected from a test subject, and detects an ocular surface tissue specimen that is evaluated, on the basis of the change in the microbial community structure between the healthy individual and the test subject, as having a conjunctival disease; and a biomarker for aging that is for detecting the state of aging, wherein the biomarker for aging includes bacterial species in the ocular surface tissue that belong to at least one family selected from among the Corynebacteriaceae family and Propionibacteriales families.
Provided is a composition including delamanid particles for which the formation of secondary particles is suppressed. Specifically, provided is a composition including (A) delamanid particles and (B) a surface stabilizer.
A61K 31/454 - Non-condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone
A61K 9/48 - Preparations in capsules, e.g. of gelatin, of chocolate
A61K 47/20 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
A61K 47/26 - Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
A61K 47/32 - Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. carbomers
Provided is a crystal of a specific oxazole compound that has specific inhibitory activity against PDE4, and that shows excellent stability. Specifically, provided is a crystal of an oxazole compound represented by formula (5) wherein the crystal has peaks at diffraction angles 2θ(°) of 9.6±0.2, 19.1±0.2, and 21.2±0.2 in an X-ray powder diffraction pattern measured using CuKα characteristic X-rays.
C07D 263/32 - Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
A61K 31/421 - 1,3-Oxazoles, e.g. pemoline, trimethadione
The present disclosure provides a composition for a frozen dessert, said composition comprising (A) approximately 6-15 wt%, relative to the weight of the total composition, of palatinose, and (B) approximately 10-30 wt%, relative to the weight of the total composition, of dextrin or a combination of dextrin with a water-soluble dietary fiber. Also provided is a method for manufacturing a composition for a frozen dessert, said method comprising mixing water with (A) approximately 6-15 wt%, relative to the weight of the total composition, of palatinose and (B) approximately 10-30 wt%, relative to the weight of the total composition, of dextrin or a combination of dextrin with a water-soluble dietary fiber.
A23G 9/34 - Frozen sweets, e.g. ice confectionery, ice-cream; Mixtures therefor characterised by the composition characterised by carbohydrates used, e.g. polysaccharides
The invention provides new pyrazine derivatives of formula (I), or a tautomer or a solvate or a pharmaceutically acceptable salt thereof, wherein the substituents are as defined herein. The invention also provides pharmaceutical compositions comprising said compounds and to the use of said compounds in the treatment of diseases, e.g. cancer.
The present invention relates to a method of production of 4-boronophenylalanine (BPA) from 4-iodophenylalanine, in which all the functional groups of the amino acid are protected by benzyl protection method, and which uses isopropyl magnesium halogenide stabilized by a complexation base, and subsequent condensation of the resulting Grignard reagent with a boric acid ester. The final reaction step, catalytic hydrogenolysis or transfer hydrogenolysis of protecting groups on the amino acid, occurs after hydrolysis of the boronate ester groups.
C07B 51/00 - Introduction of protecting groups or activating groups, not provided for in groups
C07B 63/02 - Purification; Separation specially adapted for the purpose of recovering organic compounds; Stabilisation; Use of additives by treatment giving rise to a chemical modification
NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL UNIVERSITY (Japan)
Inventor
Ohkuri, Takayuki
Kosaka, Akemi
Kobayashi, Hiroya
Abstract
Provided is a peptide which comprises 10-45 amino acids containing: an amino acid sequence KILQQSRIVQX (wherein X is nil or represents S); an amino acid sequence consisting of 10 or more consecutive amino acids in an amino acid sequence DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or an amino acid sequence QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9), or a peptide which is derived from one of the aforesaid peptides by the substitution, deletion or addition of 1-3 amino acids and has an ability to activate helper T cells. Also provided are a polynucleotide, etc. relating to the peptide. Also provided is a method for using the peptide, polynucleotide, etc. as a medicine or as a helper T cell activator.
A61K 38/16 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
A61P 11/00 - Drugs for disorders of the respiratory system
C07K 7/08 - Linear peptides containing only normal peptide links having 12 to 20 amino acids
C07K 14/47 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans from vertebrates from mammals
In order to reduce the probability that articles are not extracted from a tape, this product extraction device (10) for extracting a plurality of articles (6) aligned in the longitudinal direction of a tape (2), is provided with: a tape feeder (19) for feeding the tape (2) in the longitudinal direction of the tape (2); a suction wheel (40) that has an outer circumferential surface (41) and has a plurality of suction ports (42) aligned in the circumferential direction on the outer circumferential surface (41); and a driving part (65) that rotationally drives the suction wheel (40). The rotational axis of the suction wheel (40) is inclined from the vertical direction with respect to the tape (2) toward the tape (2) side. The rotational axis of the suction wheel (40) is inclined with respect to the width direction of the tape (2). The outer circumferential surface (41) of the suction wheel (40) is in close proximity to the tape (2).
B65G 47/86 - Star-shaped wheels or devices having endless travelling belts or chains, the wheels or devices being equipped with article-engaging elements the article-engaging elements being grippers
patents
